SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Ostta4|37929|1900010118 from Ostreococcus tauri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Ostta4|37929|1900010118
Domain Number 1 Region: 131-206,238-305
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 0.0000000000305
Family beta-CASP RNA-metabolising hydrolases 0.083
Further Details:      
 
Domain Number 2 Region: 26-100
Classification Level Classification E-value
Superfamily ISP domain 0.000000144
Family Ring hydroxylating alpha subunit ISP domain 0.075
Further Details:      
 
Weak hits

Sequence:  jgi|Ostta4|37929|1900010118
Domain Number - Region: 464-489
Classification Level Classification E-value
Superfamily Staphylocoagulase 0.0706
Family Staphylocoagulase 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Ostta4|37929|1900010118
Sequence length 591
Sequence
MKKEVLTLSPTELRELSVGINCISKSGFSLLVLKRGDGTLQACENLCKHQGGKFAPSTDI
EDMGTNIAKCTRHHWKLDCETLEYVNPPEVHKQEPLHIKYGRDGSATFLKEVAELPWREG
LPRAKLDSNELTVTYLSHACLEFKLGRHVIVSDPWLIGPAFLRGWWLKHQPPENAIERVC
NADAIWISHGHSDHLNIHTLRLVAARRPDIPIFVGELNEPIIPQDVMEDIGLTNVNIIPT
GKWYYLDENSRFMINTDDTLPEVDTWVIMEHKGHRIINFVDCSAPSAFNVPDEQVDVILT
DFASGASGFPSCFADMYGSEKVLQLANEKRRLFLRKLGDLARRTRAKAYIPMAGYFTPSH
PSDSDVLKLNRQNSPEEAVTFLKKTHPHMKAWIPFPGGRFDLCSLEGDEAPDESSYTCKS
WQFSSYTSQIESVAERAMVTREQLQQYFDWVGFADYDLVLHVVEMDEKLESIVREFFIDF
DSKKPKVVTFKPRLGKYLRMRVRSTSFRYVLHTGSTWDDLLIGFQARISVSPDVYHFKFY
NHFSNLLPRNKPQFKLSETTIERQQQKISKFNSLLVYAFILVMAVIHAMLR
Download sequence
Identical sequences Q00S34
XP_003084363.1.19543 jgi|Ostta4|37929|1900010118 70448.Q00S34

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]