SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Monbr1|12200|fgenesh1_pg.scaffold_36000025 from Monosiga brevicollis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Monbr1|12200|fgenesh1_pg.scaffold_36000025
Domain Number 1 Region: 7453-7569
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-28
Family Cadherin 0.00061
Further Details:      
 
Domain Number 2 Region: 5203-5336
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-28
Family Cadherin 0.00065
Further Details:      
 
Domain Number 3 Region: 220-338
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-28
Family Cadherin 0.0019
Further Details:      
 
Domain Number 4 Region: 5103-5208
Classification Level Classification E-value
Superfamily Cadherin-like 1.33e-26
Family Cadherin 0.00059
Further Details:      
 
Domain Number 5 Region: 426-539
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 6 Region: 5626-5744
Classification Level Classification E-value
Superfamily Cadherin-like 1.28e-24
Family Cadherin 0.00067
Further Details:      
 
Domain Number 7 Region: 5314-5416
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-24
Family Cadherin 0.00081
Further Details:      
 
Domain Number 8 Region: 2627-2752
Classification Level Classification E-value
Superfamily Cadherin-like 1.4e-24
Family Cadherin 0.0017
Further Details:      
 
Domain Number 9 Region: 5525-5632
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-24
Family Cadherin 0.00063
Further Details:      
 
Domain Number 10 Region: 842-962
Classification Level Classification E-value
Superfamily Cadherin-like 2e-24
Family Cadherin 0.0019
Further Details:      
 
Domain Number 11 Region: 948-1050
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-24
Family Cadherin 0.00067
Further Details:      
 
Domain Number 12 Region: 637-737
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-23
Family Cadherin 0.0014
Further Details:      
 
Domain Number 13 Region: 4893-5008
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-22
Family Cadherin 0.001
Further Details:      
 
Domain Number 14 Region: 739-854
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-22
Family Cadherin 0.00086
Further Details:      
 
Domain Number 15 Region: 326-431
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-21
Family Cadherin 0.00088
Further Details:      
 
Domain Number 16 Region: 533-636
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-21
Family Cadherin 0.001
Further Details:      
 
Domain Number 17 Region: 3059-3195
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-21
Family Cadherin 0.0008
Further Details:      
 
Domain Number 18 Region: 9375-9489
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-20
Family Cadherin 0.0015
Further Details:      
 
Domain Number 19 Region: 5418-5531
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-20
Family Cadherin 0.0011
Further Details:      
 
Domain Number 20 Region: 2316-2440
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-20
Family Cadherin 0.0022
Further Details:      
 
Domain Number 21 Region: 2739-2847
Classification Level Classification E-value
Superfamily Cadherin-like 7e-20
Family Cadherin 0.0013
Further Details:      
 
Domain Number 22 Region: 1157-1260
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-19
Family Cadherin 0.0015
Further Details:      
 
Domain Number 23 Region: 3774-3882
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-19
Family Cadherin 0.0023
Further Details:      
 
Domain Number 24 Region: 9267-9380
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-18
Family Cadherin 0.0019
Further Details:      
 
Domain Number 25 Region: 3266-3375
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-17
Family Cadherin 0.0017
Further Details:      
 
Domain Number 26 Region: 2421-2522
Classification Level Classification E-value
Superfamily Cadherin-like 2e-17
Family Cadherin 0.002
Further Details:      
 
Domain Number 27 Region: 121-224
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-17
Family Cadherin 0.002
Further Details:      
 
Domain Number 28 Region: 1050-1161
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-17
Family Cadherin 0.0017
Further Details:      
 
Domain Number 29 Region: 4377-4480
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-16
Family Cadherin 0.0011
Further Details:      
 
Domain Number 30 Region: 1900-2013
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-16
Family Cadherin 0.0024
Further Details:      
 
Domain Number 31 Region: 4786-4911
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-16
Family Cadherin 0.0029
Further Details:      
 
Domain Number 32 Region: 1372-1489
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-16
Family Cadherin 0.002
Further Details:      
 
Domain Number 33 Region: 2835-2966
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-16
Family Cadherin 0.003
Further Details:      
 
Domain Number 34 Region: 5001-5103
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-16
Family Cadherin 0.0015
Further Details:      
 
Domain Number 35 Region: 4086-4183
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000002
Family Cadherin 0.0028
Further Details:      
 
Domain Number 36 Region: 1688-1778
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000002
Family Cadherin 0.0025
Further Details:      
 
Domain Number 37 Region: 3584-3680
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000257
Family Cadherin 0.0023
Further Details:      
 
Domain Number 38 Region: 3987-4083
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000428
Family Cadherin 0.0021
Further Details:      
 
Domain Number 39 Region: 5845-5938
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000106
Family Cadherin 0.0021
Further Details:      
 
Domain Number 40 Region: 4691-4798
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000171
Family Cadherin 0.0059
Further Details:      
 
Domain Number 41 Region: 4475-4592
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000171
Family Cadherin 0.0038
Further Details:      
 
Domain Number 42 Region: 4583-4685
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000011
Family Cadherin 0.0042
Further Details:      
 
Domain Number 43 Region: 2119-2212
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000131
Family Cadherin 0.0026
Further Details:      
 
Domain Number 44 Region: 3681-3777
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000157
Family Cadherin 0.0034
Further Details:      
 
Domain Number 45 Region: 1265-1374
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000271
Family Cadherin 0.0041
Further Details:      
 
Domain Number 46 Region: 9111-9172
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000284
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0046
Further Details:      
 
Domain Number 47 Region: 5740-5831
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000357
Family Cadherin 0.0046
Further Details:      
 
Domain Number 48 Region: 3485-3578
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000471
Family Cadherin 0.0037
Further Details:      
 
Domain Number 49 Region: 1589-1699
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000343
Family Cadherin 0.0031
Further Details:      
 
Domain Number 50 Region: 2960-3071
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000004
Family Cadherin 0.0057
Further Details:      
 
Domain Number 51 Region: 3887-3993
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000414
Family Cadherin 0.0069
Further Details:      
 
Domain Number 52 Region: 1800-1907
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000685
Family Cadherin 0.0047
Further Details:      
 
Domain Number 53 Region: 3181-3278
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000131
Family Cadherin 0.0039
Further Details:      
 
Domain Number 54 Region: 1483-1585
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000457
Family Cadherin 0.0024
Further Details:      
 
Domain Number 55 Region: 7559-7673
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000542
Family Cadherin 0.0016
Further Details:      
 
Domain Number 56 Region: 22-128
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000214
Family Cadherin 0.005
Further Details:      
 
Domain Number 57 Region: 3381-3477
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000123
Family Cadherin 0.0057
Further Details:      
 
Domain Number 58 Region: 4284-4384
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000186
Family Cadherin 0.013
Further Details:      
 
Domain Number 59 Region: 2581-2639
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000371
Family Cadherin 0.0084
Further Details:      
 
Weak hits

Sequence:  jgi|Monbr1|12200|fgenesh1_pg.scaffold_36000025
Domain Number - Region: 7188-7256
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000196
Family Type I dockerin domain 0.0081
Further Details:      
 
Domain Number - Region: 8942-9014
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000952
Family Type I dockerin domain 0.009
Further Details:      
 
Domain Number - Region: 8746-8852
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.00194
Family Cellulose-binding domain family III 0.022
Further Details:      
 
Domain Number - Region: 8176-8204
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.011
Family Invasin/intimin cell-adhesion fragments 0.01
Further Details:      
 
Domain Number - Region: 2040-2113
Classification Level Classification E-value
Superfamily Cadherin-like 0.055
Family Cadherin 0.0066
Further Details:      
 
Domain Number - Region: 2248-2328
Classification Level Classification E-value
Superfamily Cadherin-like 0.0597
Family Cadherin 0.017
Further Details:      
 
Domain Number - Region: 6975-7068
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0628
Family Cellulose-binding domain family III 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Monbr1|12200|fgenesh1_pg.scaffold_36000025
Sequence length 10110
Sequence
MSPLLTRWLVLAALALVASAQYPPIFGQTYYVFSTVEDQTGNIGTVVATDRDGDAIQYSF
SGSSVQSTTSTLAGQLVIDTSTGTISTPTGLSESGLTTVYALSGSPRSSAQCSVVLQVAD
INNNPPTFDKSQYNVSIPENTASSNLVQVIVTDADTTYANQDYTLFFIEGNQGGEFLVST
SGIVSLNYTLDYERQTAYRLLLVAENVAAPPLNDTAWINVLVTDLNDNAPILNPTLYNVS
VSEATPANSIVATVVATDADRHDTVSYSIVDTNIPFSIGSSSGQLRLATALDYETLQMYN
FSVRVTDSGTPSRTATGTVLIHVQDVNDNAPRFGQPAGYAISVPESFNVQQQLLLVSATD
ADLPSTLNGQVRYAINETSDFIIDALSGAIHAAAAFDYEAQQSYTFGVYAHDLGSPQRTT
RVSVAITVTDVNDNTPQFQAPNYAVSVSEWTASGAAIVNLSATDADLHDTVLFSLRTTSV
PFGVDQNTGQLSVAGTLDYETRQSYNLTVRVSDTGSPSRHADTWVLVTILDENDHAPIFG
ALNGYTVAVAEDVNVANPLLTLSATDGDLPTTANGQIRYSLNGTASFAINATTGVIHALA
PLDYEQTQKYVFTATAADLGTPPRFATTTVTINVQNVNDNVPVFGAASYAVNVSESTLKN
TVILLVSATDADILDSVRFSIQTASVPFAVGQTSGELSLAGTLDYELRTSYNITLRVTDT
GSPPLYSEVQVLISVLDENDNAPRFGAESYQTSVLESVNVTQPLLRVSATDGDLPATANG
QVRYELYNALFSDTNFTVDAITGQIYATRALDYETVQRYFFTVQAHDLGSPRRSSPVINV
TILVINVNDNAPLFVDAPYSANISEATSIGTAVLAVAATDADLEQTLSFSIVDAAVPFAI
GSQSGVITLANAVDHETVLFYRFNVRVQDSASSPLSALATVTVYITNVNDNAPEFRADTY
SCTIAENSVAGTFCQTVQADDADRVNNDVTYTLSNTQGRFRINHLTGRIETTAPLDREAQ
ASYSLVATAVDSGIPPRFTDVPVIVTVSDVNDNPPQFVTKSFTRSVPENAAGGTVLVTLE
VTDADVGDASAVAFSINGGEDQFEVITTTTTPGNAGTARLRIKNTATLDYEAVRNYTVRV
TALNPGTSMSDVCTIDILITDINDNAPVFGRTSYSTRIASSTLSGTTILAPRATDVDTGA
GGVITYSLSQSDAASFTVDATTGAISTARVLTASDRSFSFAIIARDGGGLSTQATISVTV
ATTSNDLNPQFAQVSQITSVLENSPAMTRVAQFVAAEADQGLNSRLNYTLVDDRNASFIV
KTELNTNNLRVANVYTTRPFDYESGVVSYILTVVATDSINTDRRGQATLILSVENVNDMA
PTFARQTFYFNFSENAIVGAVVGQLDVTDGDPLDGGGRFYVLSDDVPPQLTVTSDGVIKV
QQTVKYEVYSSFTFTVRAVDFGANQLSSNLSTVIVSVLDENTYAPEILEPSGEGYVCLVE
EGRPAGTRCSTLTAIDYDAPGTPFSELVWSLTGSPEFAINSSTGVIYTTSVIDSSVQTNF
ALVATVRNPVGNVGSDSTNVIVRVVEQNLYGPQFDSAVRLVELAETDSARVIVDLNASDP
DHSSVADVGITYTLKEAVPGFSVVASTGALRADAGVLDYETFSRKTLTVVATDDGGIPRS
AEILVVLTLTDVNDNFPTFTTDNLVVEVAADAAIGSILSRVTARDADSGFSGSVLYSVTG
GPVPFAVDRSGYLTTTAALDALPYSFAVTATDEGDRDGFSALQSLTPISITVRLPDPGSD
LVPAFDVAFAQANVSEDASIGLGILDIPIANMSLVAFFELRSADGTNASDFAIDRNGQLV
VANFLDYETKTFYNLTIIAHGYGPSTATSSMWVAINIQDINDHAPVFDAVQVRIYVSELK
EAGSIIGRVRATDKDDAALYGAVTYQLIETFPALTGSARFLLGVDDSDNAATIQLSDPSP
LDYEQVQLYTLTIRAIDAGFRFADATVYVEVLDAPDGPALQFVDPVASIKLPTGFSGEVA
TLRAAFASPAPQQTITYTLTRMTDFAIGSVANSAGLISAPSPLSDGFYSLLVQALSSAGQ
SVSTTLNVTVAPVTPTDVQFSASNYKATLAESAPLSTNVVTVSATVNGASSASMRYAIVG
GGDRFSIGASSGVISLAAALNYEDASFHALTVRATETASGQQALATVRVTVVNIVESIRF
EANVYAVSVSECNHGDLPACNWTAPVLRAFDEGNNLVAATFNVIGDTRFVIGQDATLAYQ
VELAPGAIFDYEATSVVTTTLQATSNTLTTSATLQIHVLNVDDLAPVFVNNASLLEPIVS
EGLPVGSVVTSIAAYDPDVTTDVAPSLTFALAEPFEPFEMDGTSGTLLLRSPLDRETQDR
YALNVTATDLVGRTSAVLVNVTVTDLNDNAPVFNESVAWVEFTSPILDGSYVTTLNASDA
DIGVNRQLRFAISRLHDAGDFVVNAESGVVELSRALDVGTYSVIVTATDQGQPQLSSDPD
ANVTVAVLPPPTRPSWVVPALLVRTLNEEAPASTIYTLTPLIDDRTVTTEVVLLTDTTDF
EVVESNGNVQLRSTVPLDRETQATHTLLLGVRDPAVSPLMENLTVSVELQDVNDHDPVFV
HPYIQVNLSEAVPINTTVASVLATDLDDGANGHVRFSVDAGSESPFFFVGPAGLIVTRAS
LNYESLSNATIVLIVHATDGGGRQALPPATIVIDILNENDNHPVLNQSDYFVDQMEGETN
SALVQVGATDADGPLYPLTFSLAASDIAQGFAIDAATGVVSVTAPLDRETTDAYTLLVTV
SDGVIAYDVVASVHITVLDANDNTPVLDSSVDTLVLDENTEQVVLPFGVYASDADIGMNA
EISFALTSDPAWFTIDEATGVVSRSGAVDFELLRASTAACPTSNVNGSLIPITLSVTATD
GGTIARSTDIQLVVLVRDLNDNPPTLVDAPATYEHNESVATFPVVVGTFVAADEDCTSAT
LNFSLVNASDASYFAVVPVAPQTAELRLIKAVDREVTQTLSATLAVFDGATAIASTLVVT
VLDANDNAPAFAQRRFETDLSEAAPGTNVLSLVATDADAGQNAEIVYSISSGDPNNDFAL
DNETGLLTTARLICLSDAIEAYNLVVAAADRGIPSQRTEVAVFIRIVRAADATILYAAKD
MNVTIMEHVAIGTTVANLEIDSGNCTSSVDYSLSVLPASGTPFVIDPSSGLVTVNADLDR
ETIKEYDLIVTASTSTGVEDTKSVTVHLADRNDFPPVFAVNLTRASIVENVATAETVATV
VATDADDCSSCMLSYSITAGNAGGTFAIDEQGRITRVQALCAADRPTFTLQITASDGGSP
ALTATTIVIVAVTAAPPNTNTAPVFIIADQALEIPESRAPGVLLNAAAVDPDCGDELVYD
IVEGDLYSDFLWLTQAGNLLLVRGPDVSLLAEARVTLRVTDLDGASALLRVNITFLDAAG
FPRSNEGFPSFDLDQYNFTVVEAAAGLVVGTLSATDDRAVVFSLVGTDAQVFDIDAGTGL
LTTIRDLCAATQNAYHFTARAHDEGGLVASVPITVSVTGAPNAAPTFTADTLSLLTVPED
EAVGSLVGSLYATDSNCGDMLIFSIVSQTPSGYFLVAADSGAITLSQTLDAETTSTHTLQ
VAVSDGTVQALQAITITVTNVDDEAPVFATASASVSIPENQVAGETIYLAQATDADSVTL
RYTLTNSSRSPFAIDAVTGQVAVRGTLCAATTPLHLVEIVASDGVNAGYMQLAVTVTSVN
AYPPSFESSVYHFQAYEVQASGSFVGRVAAQDRDCGDTSFVYSIIGGQTSPATFSINADT
GAIAILRPVDYTKQTQHTLTVMASDGRSVPRTGTAQVIVSVKPNSGDLPVFTEPTYFYVV
PEDALPGHVLGMLAYRSPNNVQVAFSIVDGNEDAFMALNASTGALTIASELCYRRAAQVQ
LTARIVNTNDTSLYTDTVVRIDVLQANAHAPLFANSSADSASISETTSVGTVVLTATATD
ADCDDVVTYALLSGGDYFSIQATTGQIRIEQALAYHLHSSHVVQVQATDLLGRATSKVFT
VNVINVNTLPPRFSQGIYEMSILESRPVGSLVGTLAAEDADSTSLTYTILSGNSGLTFAL
SATSGNLTLRNTVCARDPGSFVLVVQVTDGQFTHSTVVRVTVLRDVQAPPTVALTAPVTL
YSDAAAGTAVAVARATVVECYGNVTFAVAASNAAPITIDSTTGLVRTNGPLVESAYLAAI
TAANNAGTTAFNFLLQVTTRPATTPSFSQTHYEVNVLETTDVGDVVFLPSVEANGATVTF
SQDGSASSLAVDTQTGDVRLLRSLCAALQPQLSLVLLATTATGATARASITFTVVAINAH
KPTFSRSLVTVSVAENTPPLTPILALSASDADCTPAPLAFSIVGGGTAATQSFALAPGTN
VLRTLATLDYEAQSSFTIFVRVSDGTLSSVAEVRITVTDVADQAPVWAASAYAASVLENA
PLGTTVTTVGAATPDRQALYYSLAAGNEAYGFQVGTTSGVVSLQRTLCARNQDSYNLTAR
ATVLANTAMFADVAVTVAVVDANEYAPVVRVPAAMQELTEATPVGSTLLTLTATDADCND
QVRFRIVGGQANPAHFAIDALSGAITLIRAVESAVTTTHAIRIEAYDNHPYNPRSTLVTV
GFLVLEAGALDPTFTAPLVSVTVDETIPIGTVVAQLTARDEDEPGTIVPEEFRLVGGNAP
GLFAVDLYSGNVTSTSALCAAELPVITLQVTVGEEGQPYDVATVNISVRNVNNHAPEITA
SSLNVSVSEDANIGTLVFSGIATDADCRDVLTTTLVGGDSVPPTFYVSGVDSNGAFSVGL
LRRVDREDVPLWSLTVRVSDDAGRSSTVTVHLSVTDINDNSPLFGQNVYTAANLPERTAV
GTRVATVQASDRDTGLNAALHYFFLTPTSVFTLNETTGVVSLAQTVCADIRSIYELQVVA
QDQGVPARNDTANLIISIAPVNDFQPRIAGSGTLAAMVSEAAPVNASVFSIVATDGDCEE
TLTYTIAAGDYEPPYFAIDNVTGSIIVARTLDYELVTRYVLQVHVSDGEYTDSSSLVITV
EDVNDNAPVFSRTTYTATFAETQSVGTTLLTLAASDRDSGIRGMFDFALISGNGDGRFDL
NATTGELSLLLPLDRENASSYTLGVAVTDRGTPALNSTARVIITVTDVNDNAPQFTAETF
SVYLAENAQAGDPVFTVTATDADVGVNAALSFTLLASGDAARFNMSADGSITVAAGASFD
RETQESIVLTVRVRDAGVPSLQSETTLTVHLTDVNDNPPVFAVATQNVSLSENAPGTLLL
TATATDADVGANAGIVYSLENTFSGRFTINASSGALSTTGPLDREAQAAYRLVVVASSIM
PPLQEATLDVYVTVLDKNDNHPVLQSTEYSIVLPENAAVGTLILQLNATDADEPGQPNSQ
IAYALIDGNTENLFALDTTTGALTVAISPNAEVHSDASLLIQVRDMGPGTFVLNITIEIL
LQDLNDNPPEFDSASYTGSVAEDAAINTTVTQVSATNPDVSADPIKYSIRAGNAAGRFAI
DATTGEIRVAQVLDRETTPGYVLTVRADDSVQLAQTSVTITVTDVNDNSPVFVRPTYSTA
IAESAPENSPVLQVSATDADVGLNARLSYELAGSTMLLTATNAVVPFDNASTLPFAINAS
TGQITVTAALDRETVSRYDLVALARDAGTPQRNATALVTVNVRDVNDRAPVFAQAMYTLS
LPRETLAPTALVNVSASDADLNSVLTYRAQYTEPAGVLAVNTAGTVRLANSLCALSAISL
VLVVEASDGTNVGSAIVQVNVTDSNSHAPEFSMPSTTFALPLGTPAGSDVTNIIATDADV
ACGGGQLTYAIRSGNVDNVFALDTFSGALSVARTLTSDMPGQFTLVVAASDGSLSTTLQL
DLFLVSQVVPSFAVAGTGFRAPGVSSGEDRTASTSVGFLVDSNVNGQGTLTAKFGALTAS
ARYRDAFKPAASIRAILLTDEVWFDDAQVRVALQVRDEDHSVKVASTTVVVQLVPEQALL
DIATTSISAQCTVGSSGACTVETASLPDAYFVPGQSYQVSVQYGIRDGPMSELGTVRLRS
QTSALTDDSYVDDVVQELPGRPLYRGQRFTVPVLSDPSYDVRSFTFSIVTDSNVYLESVS
FDSSRWTLVRTTSGRTNGIVANLKDASLARPGVIGRQQLLLITYRVEATAVEDAASSLSF
TVENLVTTEGSVRVRGLVGSQPGTYADRIGVSQAGSVFIASNAVKGILPYVDQSQLVNTA
VLTGSVVTANINVLACYVCSRSSAVDFCDAQCSTVSRSLASCSSADTNVAAVSGCQVRLA
GTETTGAASLLMTVTYNGRSNSVPLQVWHPSNTVLSVSDSTLNAFARWMTPAPSCSLRYQ
SADVTVTSTFAAGGSRVFTVDVTEVARAQLVAGSAAVAVSTASPPTVTGMAPGSSSVRLM
AGGRLVAAVPVEVASDPVDIIGLDVVLATAIFVLEPNDNVRFERLSMVPAECQLETALDV
EGKSATVVASAVASDGTRIAVTAADGLVLASSNPTVLVPGVDEVLAGSETDAAILSATWA
ACGETLATSEQEVSVELGDPIGVVFTQVASSVVHSSDPLAQHGSVAVKSSIRVFLQFDGS
ADKDVTDDARTVFNFPAELVDVSVPAGSTTGEIVAREAGVTGTATITVSFTHLNETLIAS
LPGNSVSLDVVRLTSVEVASAPFPVYSGSSSFSETTLSQIGPTGIYQQAELSMTLVVSDG
RTFSVDTHANADYGVYSPGTTSSATGVISIARSGSDRVVTALAAGTVDVVGSFAGMPVSS
ALVLTVSDTPVTVTALQSMTFPSTVAGFASTATGQARMHALFSDGTRYTNLFASNGNPAL
PGLVSFSLSTTVPASVDQNRGTVTLLGNYHDYVTLTATAVGTSVTASADFACNLYPDTND
ADLGNLNGIPLPPTAVGAQLNVRVALNTGSVAFGAFTVNVYYDETKLQAIDDGFILGNDW
EDGPFSARTNNPPGEYQVTGVAGGSSDRGTNYHLVTLPFTVIGSGLTQLTGVIETLNRAD
SATAVPIGTPNRQMVAGVVNVQLTGADRRRSIQVSSNNVTFGVDYEHASSRLNEDSPQRD
VAVPPPMFTRVQPRLEAARARYAQDLALHGTPANVTRQRRAACTGKAEYGDADGNCVFDI
ADVAYTLQYIVEALVDFTGSFGAAFDDITERQIKDMDADRNGVVDGTDAFYMVKALVLLS
RFVDNLVASPINDTDGSGCTLRLAVDVFEAGDEIDTSPATAPTTEVYFLLMSTRSTMKQE
LQDSSDNCVACEGEVLPLVLQSTRNRAYGGVVKAVREGETATWRMAIQTDMTYETVGSIG
VSVLVVTFSPTSETNDNRLDTIVGPPERVQSFTYNDRLEFDLPVFNGQSVGFVSTGFSPH
VSFINDLASSACTNDHAPVFENATYEVAVYENLTVGSIVLRVAATDQDVGRSAQLTYSIV
ARNDDPVNFVIDSSTGDIRTTLPLDRETVAQFQLVIQARDGTFPYRTNTTTVTVTVADLN
DNHPVFVASPTPGARFTPAGGLLAEYEVDVRVGSAENTVILQLNATDADSAPFATISYEL
RGSSASNGEYVLNAATGELTVAALILRESGSTVVFQVSAVDSMGLATDANVILNLIYEVD
LLYYTNEYEGREGSVTAHLGPAAITQSYSTVASANSRLSARLITTDVYPDATALKVLLHV
QNDVFGAPASSVSVRVQVTPGPDLLFDLGGASPTDFLREGTCLAGVATNRFSRYGVCVAT
VSVPTAWFAQASAIRHLRVSYNFVDERLTPATLGNVQLHPEVTWSLSDNVLVVMPLHPVF
IGEEATATVYAKSNFPITNYELRFESSAYLPIVGIDFPSDAWSGPVSASSDYRYTVNAIR
ELDDVADAETTEPEVIAYVRMRVADAALANSSLTLACVISALGSSKESSIRPGGQATPVE
ATFVDMATISGVDRTTTGLVRPAALQVQAFVAQAAATELVNTAILSGRPVTSGVTLVSAL
ANGTLVLQDPTAAAVSCVAGNTTVLNVREDCSELLLSGAESHGQAEASVIFALARNDSAV
LLAEAHARVWAPTLPVELEVDDTTLRRVANWSWFDTDASICRPKYQNTRLRAFATFSYGA
QAYRARVSSLVVLGASSSNTSVARVESDGQVSAWRPGNITIAIDHAQRQGRDLGSVTLTV
LEEDASSALGLLVSRLELHAFTNLTAAPLASPLVDLDSSSVVFVHQVFDVEDRVGAVAAY
AVFEDGARMELSPEQGLRLNSLDPAVLAVSATGVSSYDHAHVVAKGAGSGPLLQGTWLAE
CANDSMAELATGQAQVLVTIPKPYAVEVTVTAHELTRLTDPAALAGVPTETAVRVVLLSL
AADGTTVRRDMTTDDRTIFNSTLANGLFSACADNDVVCGASSTALGSSGPVVRSVSDATG
NGAAWLQVHFTHVDVVGNVSLTLVTARETRVEAHPYPAYTGSSAYDVSVLRRYANPNTAA
TAVRQRAVLSVVVELSTGEELDVTSLPSTTLRLTTIENETVPSTLVILDLNLRVVSVAAA
AETVLLTSDIYVVARATLGNFTALPVALRATDEPDERAAVVGFENIRVANAPVVNGAFVL
QVVSGSYGQVACGAHFSDGTQHPNLVAADGTFLLPGALSFGSSQSSVITTTSTGRLILSE
NYELPITITLGLRNAIVFASVSVIANPLPAVGDVDLGRQGNFPLADVLVGESFDVPVYIN
TGTLPLGAIDLQIVYSSAHLEIPTTSAGVAVRRGRDWPGGSVYAVVDPPGTLSFGGVTAV
DSTAKGELLEIAVVTFRALTATAGSIPIQGHVVTMASNDLQGTFIGSAEERDFVAGWNVF
VRVAATGNSRRRRAENTVARSSPTEAALSMDLPLPSALTPRARRSANSCTTAPCAACPLT
RENGDTNGDCVFDIRDVGYLQTYLAERQLDFARAQGQILNASLIPVQLSNMDANLDSVIT
VADAEFLARVNFGMLRFPAELTIVPVQDKTSGGYINVNVTVRGKGDTQTRSDKTMIFVDF
AYDNPSVQPLFESTQLYKGTRRTEGDKPVSMAGFVVQAEREGPLYNNFEDTTPPNRCYQQ
AASGNTCSSGVRGPRFYFNSGTETCESFEYFGCGGNTNNFATLQACVDMCVPSFRHSVML
NTSLKLDNIGVSLVMVTFSSEGQVNVGRDVFLTGVVSGDVPYATLIDYQLSLQAFAGAPL
QTVQVLASSGYAPLLTFNNTMTTAEAVNDHAPVFSGTLQTRIREDHDNSTVLYQLNATDN
DEGQTGLITYRLESSSVIVEGEDFVVPPFRLNGRTGAVTLMQAIDYEVSKQHNVTVAATD
NSPPRPRTTLATLAVAVTDVNDNAPIFAQSYADIRISVDTPVNTALTRLSATDADSNTVE
GGPNARITYHIVGDDAFAISDTGLITTASEQSRALRSTVRFIVNATDGGTPTLWSTAEVV
VAVINDDYLVTLTTAPDYDTFNSLYDNATGIHPCLEVLAQTLNGELRDIEVSRNPSSPTE
LTDITFYVLTSGGEVRSASEVEDDLRSITDFQQCTLRALGGDTDNAFQVSLVHFDDSGCR
DPLTDLSNLTRVFHGECLNDEAAGRSSRVTVLSNGLMDVDIYETPNCNGVAQQFFSITNN
TCVTVPSLDPDRSAPYSFTATYELFEDSEETASTSRAAIPAGFIAAVASASLVALIILLV
LLIRFQRQRRQIINARKMVLAHHGDVTFGTPEPMRKEHDQQTVFAGGEVDPLTGEVVQYK
ETTNVVDEDRTGGPMPSMFGGLRSNPLFGNRTAFSGLGMEGEEEVVASDSDESDDLSDLS
AGAMDEIMDDLSDFEMFEQDYLEATAATEGAPAHAGGQFKNPPFLSGGGGGAFDLDDLSD
FEDVTEDGPAEPYLRVEASDDSDFSTDDEEGGAFGAMDDLLNMAPLRSILKSPGADSTNS
GPRKVSFGEDDSDADDDDDERHDEMGQATLYRQRPGRNQRRQIDSVDIEAELVIPQVQYE
DVVANLQPMSQGQGGGPASTHGGADPQDSDSDFSTGPAIADRDSVSESDSDDSDSDSMDY
GSGFEDEDDDVGTSQFAAVRGMWNSSHLRN
Download sequence
Identical sequences A9VBI6
XP_001750073.1.20067 jgi|Monbr1|12200|fgenesh1_pg.scaffold_36000025 81824.JGI12200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]