SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Monbr1|23706|fgenesh2_pg.scaffold_4000449 from Monosiga brevicollis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Monbr1|23706|fgenesh2_pg.scaffold_4000449
Domain Number 1 Region: 2737-2863
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.18e-19
Family Cellulose-binding domain family III 0.0035
Further Details:      
 
Domain Number 2 Region: 3526-3613
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000564
Family PDZ domain 0.021
Further Details:      
 
Weak hits

Sequence:  jgi|Monbr1|23706|fgenesh2_pg.scaffold_4000449
Domain Number - Region: 2884-2948
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000157
Family Type I dockerin domain 0.0092
Further Details:      
 
Domain Number - Region: 555-596
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000774
Family TNF receptor-like 0.0022
Further Details:      
 
Domain Number - Region: 1615-1640
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00942
Family TNF receptor-like 0.0028
Further Details:      
 
Domain Number - Region: 789-848
Classification Level Classification E-value
Superfamily TNF receptor-like 0.018
Family TNF receptor-like 0.016
Further Details:      
 
Domain Number - Region: 1567-1592
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0314
Family TNF receptor-like 0.0032
Further Details:      
 
Domain Number - Region: 691-716
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0322
Family TNF receptor-like 0.0032
Further Details:      
 
Domain Number - Region: 667-692
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0341
Family TNF receptor-like 0.0032
Further Details:      
 
Domain Number - Region: 1663-1688
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0361
Family TNF receptor-like 0.0032
Further Details:      
 
Domain Number - Region: 1591-1616
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0372
Family TNF receptor-like 0.0032
Further Details:      
 
Domain Number - Region: 643-668
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0377
Family TNF receptor-like 0.0032
Further Details:      
 
Domain Number - Region: 1687-1712
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0392
Family TNF receptor-like 0.0032
Further Details:      
 
Domain Number - Region: 715-740
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0405
Family TNF receptor-like 0.0032
Further Details:      
 
Domain Number - Region: 1639-1664
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0419
Family TNF receptor-like 0.0032
Further Details:      
 
Domain Number - Region: 595-620
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0433
Family TNF receptor-like 0.0032
Further Details:      
 
Domain Number - Region: 619-644
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0438
Family TNF receptor-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Monbr1|23706|fgenesh2_pg.scaffold_4000449
Sequence length 3677
Sequence
MHPLLLLLLLLPQPPPPPHLRDLPHLKVSHLGCPQSSERYFDSTRRPLSRQCAVIFDLPL
PSRSSSQNLPSDLEPSVEPHHPKARAPWRQTNPMLDPVADVAQDDHARHPLRRKRDLTNM
ADVEAAAAATATATASPTPTLVPCPDGYFLHPSGVCHPCTSCQDHQYRLAPCNLSTDTIC
QNLTDCSLSQYQASQGTDTSDRICLPLRQQCIPLTFGHNFFSFHVLDRSGSQRVDPFLPN
LTAATFGDTLEANLAVAIYLGSWLQTSALPDVYGTFFRLYTSHPNPEAWCLRGRPMNLSQ
TIPVVNGFNRLGYPNNIAVELTLGLAALPQINGMTIYRLPVGTGNPAIQLGGTWFTTDLT
TIQPGAAYILTIPEDGLVDGNQFQNSMQLMANASINGQPLRNPSARLASFTDGRLSGTVS
SMLNFGDQYFFLMAVGGNNAGEVVTLKIYDPDLDLVLDANESFDFQPNGRQGDVVSNSLF
ELTAQATASCNYSLQYLDEQGECQQITTCTEDEYVLNEATSTSDRTCVNLTECEGDEVEF
VAATATSDRTCRLSCTLGVTYAWNASHCEICSTCDSGEFEAAVCTNTSDTVCQPCATCDS
GEFEAAVCTNTSDTVCQPCATCDSGEFEAAVCTNTSDTVCQPCATCDSGEFEAAVCTNTS
DTVCQPCATCDSGEFEAAVCTNTSDTVCQPCATCDSGEFEAAVCTNTSDTVCQPCATCDS
GEFEAAVCTNTSDTVCQPCATCDSGEFEAHGCSALNDTVCQACSICAAHEFEVGPCSGDT
DHQCQNLTICVGDQIESSAPTATSDRLCELACEDGLTFDDGDPVACEVCSTCGNGSFTVS
NCTVVSDTSCTACSTCSTHQYLEKACTPWSDSVCHNLTICNSTREYESEGPSATSDRTCA
DLDVCDFQIEFVAANATATSNRVCQLLTECQGDQYEVEAPTMYSDRVCGGIPTFNSSVYI
YGQLASGSGLGGVVIEGPTQVARGEYDFSVVAGASGTFVASAVVAQGVSSFTSARRAATS
LRGYASPSDVVYGDNGRITVYVQAFDDVGSTQVLPGTLVSVRLNPHGTLVTDASQPVTGS
CTVDAMDGICSVTLSLRETWLMGTASDEDHITVEAGLASPDEVQLGNISVIRQLATAISD
NIWIDLPQTSMYAGASAVARIYSNTTYAIGGFTIQVTCEGSDILIEDASADSNIWSGARA
LLPNGTSVRLVYTLKSGQSAPVDASGAALLAEIQFAAASTLNGVEVFSLIRLETRGLLDT
ADATRVPAGEMTFPVPGIVVSRDGDVTSLLSISQIQATSSAILSVEAGPTDLSGDVRVRG
IEVGSSELRVVRGSTELGRTGTISVLSTSVRAVAMDVRAISQVRANFMGTVGSMPSVERV
RVQVVEAALKAEGSSVRMVASAVYADGTREPLTAALGLMFNSSDSQQITMSTDEASVAVG
AASGVGPYVHAAWSSVLANGSVCENARVASGFGNLTIDLPPPSSVSISGVVSRYVRTDDV
ARFAGVSTGSELIQSSLRKCISKRYDSGGRVQRFEHLLYPRTGYTVQHGEFEAAVCTNTS
DTVCQPCATCDSGEFEAAVCTNTSDTVCQPCATCDSGEFEAAVCTNTSDTVCQPCATCDS
GEFVAGVCTNTSDTVCQPCATCDSGEFEAAVCTNTSDTVCQPCATCDSGEFEAAVCTNTS
DTVCQPCATCDSGEFEAAVCTNTSDTVCQPCATCDSGEFEAHGCSALNDTVCQACSICAA
HEFEVGPCSGDTDRQCQNLTVCGNDEIVVQPATTTSDRVCASIEHSIVPIEWSAAVSPPE
FAAFEWCEGNQSCSVLTNAAEVLVTADVGSLSSSSTLYFDVRSPVAGLHLQAATPQVFRP
ANPADSARLDLFVWTTDRLGSLTPAREDIIVDLAHPLSNSVLSRVLKPGDQAISAFTFDI
PYDWFSSQSATVSITASYAAQDLSADSTIQLVRPAAAMNDAENAILMYLPTAPQIGGDSF
SVEVWTDVTENVSSFTLSIEWDATALALESVKFDAGEWQGRYSSAGKELAANGIHVGSGD
SSYSRLLSATFRGLPDGGRAMLSAQGSLHDENNNPIEVDGSFQDALLTIVSRDGRDTSGY
VYLTNLEPILLLGTSSLPFWVDTSRLETDSNTGIEIHLVQLFNDGTVASTDVQSCRFAGS
LRTCSPAQASEDGTHSLEIFAGELSANIDVIIYRPSNIAVLVDDLELNRLDLSNCSTRYQ
RSQLRLQGVINGREVDLSAYLKPSHVSVDDSDVAAIGVAPSGSLYVQGVSPGSTVVRVAM
PGFESDLTVLVTPAAVEPVQLSVEVITTIAIEQDTLEAVVRLSSEFVREKQQGWLIAQVS
YSDATSRMPRDQDLQLDMLQAETAVDINGTALTAISQANNAVLQVTLLPDSCVVAQPITA
ITPLDLHLPDPTGIVVSVSSAAIAAANSVAACAGITTQATLSVVVQYPGYSLDLSRDDRM
RVSLPETLNLTDTRLVVTQAVPGLYLVNVSFLHINLTGSVAISVAVVDELRTVLRPWPAY
AGSGSVIMNSLHPIEGTDVIQRAQLEAVVTLLPNSLGSIDVSHMLSVTTPDTQLSIVDTN
RIVPLSVQSGLRSVTVQFCSLETVVDVVLSQVPRRIAGIFPTAFPSTLSGIAGSSVQLQI
DVELDDGTRWNAADSYTSEGDYLLAGAVIWESTDSSVVVDGENGMLLLMGNSFTATEIFV
TSPFTSANARVATFVNLVPEPGDIDLGASSGAALGEDWGLGGSLTIPVRVNAGLTGLAGL
DLTIEYDPAVLAIQAVEPGSDWVGNSFIFTANDPPGQLRFGGTTTTNDGIVEVAVITFSI
MGTETDPALHGYATSVSDAERRGIGSPTPRAFVAGDLRVVGPDRFRRGRIDATRWRRDQC
ATHKVVGDADADCVVGVNDVLYLQDYLVQAQVGPTAAPPLEPGQLDVDLSGDVTILDAVH
LLRVVFGQLRLLSQPTVTSVRTGPYCRVVITVNMTMATQAPAVNRTFVYFDVEHPNLAGS
WEAVQADPGLDSIKTGAGLGGAVVRARGLASGLYEAHLEGLPTVQGVGLSVIQITTDQNG
GVVASRRFLHVGSRVGSFAYPAFTFDVSAPAAAAPLPTAIFGYSPLLRFDVGRGGACGNF
ASTTTTAEPTTLPSQADDYDFLASTTWIVVLIVLILLVCCCLCLCFCCWRRRMPQDKEGD
DVTSESQLSGRRAKYDVARAHAKGYDFNNAMHEPVTLVSSRRIGSYYHEDAEEPVQPEMI
NLNLMSFKEHDVDVSDTGHDVQLGEGPVAETILSGAGRSKNPFLPENNDPDEDLYSDDED
LYSSRASDNSLVAARSNAQKSKQGATDQFQAVLHNPTYDPFNVREVPSLDDDMATSMGGA
TAMTSLSGRSSLRPSTSAATPPSAGRRGASKALPALRETNIDSSMPDNGARAAPHEDDFV
ILDEHDRPMTAAATELSSIELGASRAGGFDDASGIQAFSWLPGATSKAGRAFEQSMDGGS
TEVTSMTPELPHHMDDFDEVMSPMSKSMTAATRTAAPREVLRKYGEPHLLELVVEKGPGE
PLGLVLEERTDEPGVFIGSVALDSPCRDLVQEGDELLAIGATNVRQSGLDRAREELSAAT
QFQPIPMVVGRRAELQDTSLRDLASAGTGKFSLARPLRKAGLAQAENGSQRFKNTFSVND
FTPTHPGVDPDGDDSEI
Download sequence
Identical sequences A9UU81
81824.JGI23706 XP_001743798.1.20067 jgi|Monbr1|23706|fgenesh2_pg.scaffold_4000449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]