SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Monbr1|27653|fgenesh2_pg.scaffold_20000121 from Monosiga brevicollis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Monbr1|27653|fgenesh2_pg.scaffold_20000121
Domain Number 1 Region: 4804-4910
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000263
Family Ankyrin repeat 0.0024
Further Details:      
 
Domain Number 2 Region: 2750-2823
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000167
Family Type I dockerin domain 0.0044
Further Details:      
 
Domain Number 3 Region: 4333-4406
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000167
Family Type I dockerin domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Monbr1|27653|fgenesh2_pg.scaffold_20000121
Sequence length 5165
Sequence
MIGSKSCANRAALLGALPLAIATIALTCPWASATSNYSVIRHLNGPGETQYVPVSDAFST
IDLSTLAAPLGEQTGRVAKETWDVVHLSGGPSGMAENSIVSLGLGEMSAVVDASAVPAVS
ANNTQSQLHTVQVQMLTPILWPSITEIRVLLRGLDRNGRQLTGGGVTAYARVVKPSDVAG
EAALVQGCQLAPGTGTCVVSLEVPAAWYSEPSYVAAGSLLGTRVVPVFGLTTASGTVSSS
FGRLTLRPEGSAVVSARSATAAGSLHVTLPYSSVEDASGAARVLLSTRVSAAGLDSLTMS
VSFEHQAFVVSGFEPLAPVDPTALASVAASTGMVVLTQLGVSGPRTEIVELGWLLLDVNT
TVQAQLDVLETMNVSVAATVIGMTDLAGNALGVDVSVVQDAYGLQSAGSSTGTGTMVMGS
GRAVLAAFAVLEDDAVSSFSGLTGVPDQFNVSVYYARSGWTRDIVLYGSGEVAGHAGVDL
SCSGSANVENGYGHLSASCLELIVNGSHSTGTAASSLALTVRAVRRDGSATTESSQNKEC
VVSASIFVVGESEVVAEKSTLRRVTDLLPASVGDEAACQDYQYEWCRVRVTATLQAVTGS
GGVLTSAPVDVTAIVGARLRSNDTSIATMRRFGPSVGTGMSANLVFVQGIAPGAFVLELG
QDTSISSSVLASSETLLCSDLGRVNVLGLEAIYVTGLEARLALPVRMGPEANTSIVLTIE
REELYRVGEAPGAVLVSALLDDETRLPLTLGGSAFGWRSPQDGELVMQSIAPATVAVLDN
GYGVEVVAGALADHGGLLEVVWRSGNISNGAEHCDASGTAGKVLGRGLVQVAVNVFAPQQ
LNGIDSGAVPISGLYSPHIGSRLDAQDIEFPSSFLNASMATDGSSLVRPVGYVVGSVSDY
RRELELGEGTVTLGLGEMSAVVDASAVPAVSANNTQSQLHTVQVQMLTPILWPSITEIRV
LLRGLDRNGRQLTGGGVTAYARVVKPSDVAGEAALVQGCQLAPGTGTCVVSLEVPAAWYS
EPSYVAAGSLLGTRVVPVFGLTTASGTLGVSGPRTEIVELGWLLLDVNTTVQAQLDVLET
MNVSVAATVIGMTDLAGNALGVDVSVVQDAYGLQSAVLYGSGEVAGHAGVDLSCSGSANV
ENGYGHLSASCLELIVNGSHSTGTAASSLALTVRAVRRDGSATTESSQNKECVVSASIFV
VGESEVVAEKSTLRRVTDLLPASVGDEAACQDYQYEWCRVRVTATLQAVTGSGGVLTSAP
VDVTAIVGARLRSNDTSIATMRRFGPSVGTGMSANLVFVQGIAPGAFVLELGQDTSISSS
VLASSETLLCSDLGRVNVLGLEAIYVTGLEARLALPVRMGPEANTSIVLTIEREELYRVG
EAPGAVLVSALLDDETRLPLTLGGSAFGWRSPQDGELVMQSIAPATVAVLDNGYGVEVVA
GALADHGGLLEVVWRSGNISNGAEHCDASGTAGKVLGRGLVQVAVDPAPLHGILPFPLVT
TSGLLVDSTLYINSTSLESPVEFKSTVRADPFSRSMSFDIPSISSQSYSISQPPRIAAVV
ATHAHILKVDVTPDSLDTSVVLSVERESQRQMPSDIELQASLKLSDDVDAAVLPRHVNGS
CTASAATGACIVQLQLPSSWLLNRIDINGTGLQDGGSAQLYASIGEQPTIRSNGTTVLLR
ALGPAATVASPALEAGGLLAELPMRQLLPEETFDVPVFGMWSRSLQAFSFSAAVDEGLVI
DGFTGSSGWTGEVLALDSRNVTGTFIRSGTGSSAGLQLLGQLHLVVRTETELGLGFAEER
EVGVTLMTLFLSDVNGQEVINDMAGAELATRYGRVEAGGHGLGHVVVVSGERVVGLVSYL
PDSVELINTAILTGNVEERELAHLIVRRKDLQRFVGFSQEDSALSLSCNGSGDGLPAAPF
GVSVDCHSIFMNSSHSNAGIGIVDVSLTQVGVAENLRSSIKAAVWAPELPVEVLVDRAEL
HPVAEWIDPSITNIADCNKFQYQTGTVEVRARFSLGNGDSERVVVTDLLAASLYVNETGV
AKMRRLVGAPMVQGVAEGSVVVEARRASDGALLGHSDTIIVGPHDVSPIVVLGLDAILVH
DVDVSLRAGEGANGTDLVDVTLRRDSLSEEGIVDANVLVSAVFDDGTRMPLSVEPAVLQS
SDGNVSVHSLAPASLSVDATQTIAVVRDAVNSEGGLLEAVWLSAASAACPSRLIGRGDIE
VRVAVPPAESVMIDSSATVIASGDDPASVAGIAVEAQLRVALIYPGQRQVDATNDNRTVV
ELMGDNHLVSLSQVDGGAFVILARPDAAGQSGTVMVRIGFVHEPISTTFNLSVVSGSDVE
MSVHPYPSYSGSRDVQADTLAPYSGSQPLQYQQAIVSANLILSSGAKLDISMAASSDFVL
TPAGAAVSASLPLLMRSSGQYVVGTNLSSALTTDAMVTLFATYGASGRRQVNSSVGMPLT
FTSAPVFVSSFSGFRLDSGNTLRGVVDEASSRLRASCTLSDGRQLSDMFPGSSGVLIPGL
VEFTSSRSDVLDVDATTGRVTLRGNAGNEIELRIIARSNSSVSASVSVAGNLDADVGDVD
LGADAGLPVPASQSVGTSFTLGVYVNTGGASAGAYAFEVLFDPEALAATEAVASVDGIFS
ARFDENRVVFGGTVTAGAVQGTRVQVASLTFEVVGSGTTTVSGVVTTLSQSSVDAADIGL
ETPRSFVAGRIEIQLGSDRRRRAGNAMQSATLATMRQRRAGTVATGYERVGDVNGDGILS
VRDTQFLLQYYNNRFSNFVGAQGAQILAALSGNNYSQGELDADQNGEINPRDAIYVNQVV
FGLWRFVRGTHVDEVAATTACELVISLHVVGAGGMAASYDTTRIYVDFEGGESLRGNETV
GRMLAASAGLESVGRFWTANKSASAELTGVVFEAMPGNASGESGGDAGLWQVRVPTSLVA
TGVGLSIIQVTLETSEPRFLVGAERSPYANGAELVVTVDRPSLPTSANAREVVSSGVVAG
YNPLLRFNNTMDTITCKLEAGICAIGPCAAARAIAGQCSLAEKSECLLLNTTYYPSIVGA
FGVRSSVLPMPESAAFVETLLSPAWQNASTQDLGAVVESTTVSFLSSGLSLALGEQNVLL
QLDGSASAAVRTLTKAMPAASKVSVASLTMQEACPEDVSVTAVVQGRAARGSVIFGGSRE
LRASLKLSDDVDAAVLPRHVNGSCTASAATGACIVQLQLPSSWLLNRIDINGTGLQDGGS
AQLYASIGEQPTIRSNGTTVLLRALGPAATVASPALEAGGLLAELPMRQLLPEETFDVPV
FGMWSRSLQAFSFSAAVDEGLVIDGFTGSSGWTGEVLALDSRNVTGTFIRSGTGSSAGLQ
LLGQLHLVVRTETELGLGFAEEREVGVTLMTLFLSDVNGQEVINDMAGAELATRYGRVEA
GGHGLGHVVVVSGERVVGLVSYLPDSVELINTAILTGNVEERELAHLIVRRKDLQRFVGF
SQEDSALSLSCNGSGDGLPAAPFGVSVDCHSIFMNSSHSNAGIGIVDVSLTQVGVAENLR
SSIKAAVWAPELPVEVLVDRAELHPVAEWIDPSITNIADCNKFQYQTGTVEVRARFSLGN
GDSERVVVTDLLAASLYVNETGVAKMRRLVGAPMVQGVAEGSVVVEARRASDGALLGHSD
TIIVGPHDVSPIVVLGLDAILVHDVDVSLRAGEGANGTDLVDVTLRRDSLSEEGIVDANV
LVSAVFDDGTRMPLSVEPAVLQSSDGNVSVHSLAPASLSVDATQTIAVVRDAVNSEGGLL
EAVWLSAASAACPSRLIGRGDIEVRVAVPPAESVMIDSSATVIASGDDPASVAGIAVEAQ
LRVALIYPGQRQVDATNDNRTVVELMGDNHLVSLSQVDGGAFVILARPDAAGQSGTVMVR
IGFVHEPISTTFNLSVVSGSDVEMSVHPYPSYSGSRDVQADTLAPYSGSQPLQYQQAIVS
ANLILSSGAKLDISMAASSDFVLTPAGAAVSASLPLLMRSSGQYVVGTNLSSALTTDAMV
TLFATYGASGRRQVNSSVGMPLTFTSAPVFVSSFSGFRLDSGNTLRGVVDEASSRLRASC
TLSDGRQLSDMFPGSSGVLIPGLVEFTSSRSDVLDVDATTGRVTLRGNAGNEIELRIIAR
SNSSVSASVSVAGNLDADVGDVDLGADAGLPVPASQSVGTSFTLGVYVNTGGASAGAYAF
EVLFDPEALAATEAVASVDGIFSARFDENRVVFGGTVTAGAVQGTRVQVASLTFEVVGSG
TTTVSGVVTTLSQSSVDAADIGLETPRSFVAGRIEIQLGSDRRRRAGNAMQSATLATMRQ
RRAGTVATGYERVGDVNGDGILSVRDTQFLLQYYNNRFSNFVGAQGAQILAALSGNNYSQ
GELDADQNGEINPRDAIYVNQVVFGLWRFVRGTHVDEVAATTACELVISLHVVGAGGMAA
SYDTTRIYVDFEGGESLRGNETVGRMLAASAGLESVGRFWTANKSASAELTGVVFEAMPG
NASGESGGDAGLWQVRVPTSLVATGVGLSIIQVTLETSEPRFLVGAERSPYANGAELVVT
VDRPSLPTSANAREVVSSGVVAGYNPLLRFNNTMDTITCKLRAGLCCTACEDGTYASDCG
FENGPGTCDKAHTLLSTSNALSDAVSPVQNQLAGYPSRALLLVGHRREYRGGTKHCATAS
PQDCFPTKHWADFLLAEEALKRPPTAIVPSTQRPSVIEDDSASEGYMHVAEESRRPSVAA
PTATLLSTFGFEMTTFAVLPDESSDVADAHKSGAKRKSSQYLDVSEDLLHGLSTHPGVVL
RVCCLNDDVEGIEKVLEDFQDAAACLLRNGASVDQASTKFHNTALHFAALRRLFQKSLPA
TDACDSQGCVALHHAARGGFLPVVVLLVEAACTIDVKNNEEQAPIDAAEEDSLEVKEAAP
EIAEYETVTARDDDLYDQVQTTPRSSRVFSSPLGMHTVRIPLDYENPQDALAGETLMAAE
SDDASERDESHYVTSAEVRARKASHASQVSAFEVPRAVEEPLYDNDELEAYAEYAEEAQI
EFMDVSEADDEGSVVLPTAMENPVYDNDDVNPAALLAMLEQHRDESDFGEDDDLEVARAL
NEIADDAVGMFEHLNALSREQTTRHNVNEAARIGRLNIPELRESEQARHLRDVGRLQVPS
AFANL
Download sequence
Identical sequences A9V5X7
jgi|Monbr1|27653|fgenesh2_pg.scaffold_20000121 81824.JGI27653 XP_001748068.1.20067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]