SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Monbr1|30335|fgenesh2_pg.scaffold_48000016 from Monosiga brevicollis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Monbr1|30335|fgenesh2_pg.scaffold_48000016
Domain Number 1 Region: 9607-9896
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.23e-45
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00033
Further Details:      
 
Domain Number 2 Region: 7440-7575
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-30
Family Cadherin 0.0018
Further Details:      
 
Domain Number 3 Region: 8420-8553
Classification Level Classification E-value
Superfamily Cadherin-like 9.99e-25
Family Cadherin 0.00082
Further Details:      
 
Domain Number 4 Region: 7865-7983
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-24
Family Cadherin 0.002
Further Details:      
 
Domain Number 5 Region: 8843-8971
Classification Level Classification E-value
Superfamily Cadherin-like 6e-24
Family Cadherin 0.00085
Further Details:      
 
Domain Number 6 Region: 6903-7015
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 7 Region: 8737-8861
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-22
Family Cadherin 0.0017
Further Details:      
 
Domain Number 8 Region: 7759-7883
Classification Level Classification E-value
Superfamily Cadherin-like 1.28e-21
Family Cadherin 0.0014
Further Details:      
 
Domain Number 9 Region: 3549-3674
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-21
Family Cadherin 0.0024
Further Details:      
 
Domain Number 10 Region: 8957-9071
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-20
Family Cadherin 0.00096
Further Details:      
 
Domain Number 11 Region: 3041-3173
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-20
Family Cadherin 0.0061
Further Details:      
 
Domain Number 12 Region: 8636-8741
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 13 Region: 1324-1457
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-19
Family Cadherin 0.0016
Further Details:      
 
Domain Number 14 Region: 8082-8188
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-19
Family Cadherin 0.00075
Further Details:      
 
Domain Number 15 Region: 1107-1235
Classification Level Classification E-value
Superfamily Cadherin-like 1.08e-18
Family Cadherin 0.0021
Further Details:      
 
Domain Number 16 Region: 1437-1548
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-18
Family Cadherin 0.0015
Further Details:      
 
Domain Number 17 Region: 7224-7349
Classification Level Classification E-value
Superfamily Cadherin-like 1.07e-17
Family Cadherin 0.0022
Further Details:      
 
Domain Number 18 Region: 9175-9310,9343-9375
Classification Level Classification E-value
Superfamily Fibronectin type III 7.16e-17
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 19 Region: 8529-8643
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-17
Family Cadherin 0.004
Further Details:      
 
Domain Number 20 Region: 7006-7122
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-16
Family Cadherin 0.0033
Further Details:      
 
Domain Number 21 Region: 7544-7692
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-16
Family Cadherin 0.0039
Further Details:      
 
Domain Number 22 Region: 7336-7452
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000011
Family Cadherin 0.0015
Further Details:      
 
Domain Number 23 Region: 3762-3884
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000186
Family Cadherin 0.0026
Further Details:      
 
Domain Number 24 Region: 3458-3566
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000314
Family Cadherin 0.0028
Further Details:      
 
Domain Number 25 Region: 9067-9174
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000314
Family Cadherin 0.0042
Further Details:      
 
Domain Number 26 Region: 3348-3462
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000443
Family Cadherin 0.0017
Further Details:      
 
Domain Number 27 Region: 4701-4807
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000002
Family Cadherin 0.0017
Further Details:      
 
Domain Number 28 Region: 5026-5128
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000243
Family Cadherin 0.0038
Further Details:      
 
Domain Number 29 Region: 8005-8102
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000257
Family Cadherin 0.0032
Further Details:      
 
Domain Number 30 Region: 3145-3268
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000007
Family Cadherin 0.0043
Further Details:      
 
Domain Number 31 Region: 7124-7236
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000286
Family Cadherin 0.0023
Further Details:      
 
Domain Number 32 Region: 3662-3773
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000571
Family Cadherin 0.003
Further Details:      
 
Domain Number 33 Region: 4802-4941
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000111
Family Cadherin 0.005
Further Details:      
 
Domain Number 34 Region: 8221-8321
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000113
Family Cadherin 0.0032
Further Details:      
 
Domain Number 35 Region: 5239-5350
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000642
Family Cadherin 0.0037
Further Details:      
 
Domain Number 36 Region: 1538-1654
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000101
Family Cadherin 0.0046
Further Details:      
 
Domain Number 37 Region: 8315-8431
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000103
Family Cadherin 0.0031
Further Details:      
 
Domain Number 38 Region: 1646-1751
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000214
Family Cadherin 0.0068
Further Details:      
 
Domain Number 39 Region: 911-1052
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000302
Family Laminin G-like module 0.036
Further Details:      
 
Domain Number 40 Region: 3255-3360
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000314
Family Cadherin 0.0026
Further Details:      
 
Domain Number 41 Region: 4915-5025
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000124
Family Cadherin 0.0092
Further Details:      
 
Domain Number 42 Region: 4581-4700
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000124
Family Cadherin 0.0032
Further Details:      
 
Domain Number 43 Region: 5130-5230
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000642
Family Cadherin 0.0054
Further Details:      
 
Domain Number 44 Region: 1225-1327
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000116
Family Cadherin 0.0033
Further Details:      
 
Domain Number 45 Region: 7670-7762
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000471
Family Cadherin 0.009
Further Details:      
 
Domain Number 46 Region: 5338-5438
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000157
Family Cadherin 0.01
Further Details:      
 
Domain Number 47 Region: 2949-3053
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000286
Family Cadherin 0.0064
Further Details:      
 
Domain Number 48 Region: 626-674
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000586
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Monbr1|30335|fgenesh2_pg.scaffold_48000016
Domain Number - Region: 2841-2939
Classification Level Classification E-value
Superfamily Cadherin-like 0.000157
Family Cadherin 0.0088
Further Details:      
 
Domain Number - Region: 677-728
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000259
Family Laminin-type module 0.021
Further Details:      
 
Domain Number - Region: 673-786
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00068
Family Growth factor receptor domain 0.0016
Further Details:      
 
Domain Number - Region: 497-563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 561-610
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family Laminin-type module 0.039
Further Details:      
 
Domain Number - Region: 345-400
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0126
Family Galactose-binding domain 0.04
Further Details:      
 
Domain Number - Region: 6652-6716
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0294
Family Type I dockerin domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Monbr1|30335|fgenesh2_pg.scaffold_48000016
Sequence length 10056
Sequence
MARRRLPGLPPLLAALILSLGFSELPQAAALPSYVRASSETTCTSADEAYCRYTLTPEPA
CLTTVNCAEPCTYSGAAPSFINLLTTARPGFNESVGVPLNTSTPPLAVPITQQPHLTRAN
GYALRLGFQLETITPDVQHLFAVLINQGSTISSAVALNASAGRLLVQQRDAYFQPHQVEL
SLSSAPLETGTRYEWTISFYRRDLVVYDSAGRVLASWYYDPASFPQTFIDPSQCGSDRPF
GCQVDQMLVGGDTATVASFTGRFYQAQLASRMATQSDVLHALAVAEDFPVHFAFVPAAVA
PACRCPPTHPVLLDELSTPNTCVEIPTRPAPRNTQDRVLQTGAAFAPGFVLDGDEQTAWQ
SALGSNATLTLDLRGPHYLDRIELDVLSALPDEIRLEIAQTSDPAEVAWTLLGVLRADCA
FASTAPCQSYPRTADGAAVSTGTVAFQTSFPNVTASSAALAAVTATQLRLSFVGLGVPEL
AQSHYVTIGTIAGSIRCACHGFELECGPEPVRSSPPYNSTLSCSCGGNTIGSQCEACAPL
YNAKPFRPALGPAAAFTCQPCTCHGKADACVYSAAHDPHPDSWTVGDGGVCNCTAHTTGR
QCAACADGFFLPSNRSITEVDPCRPCVCNAAGRATATCQDGDGACSCKPHVQGSTCDVCA
RGFFNLSAANPEGCQACVCNEAGSRHNNTFFCGQDEGGCLCKDNVLGAACDTCRPGFFNL
STAHDQGCIACHALCDPLQSCSGSSSSDCDACRFARNDDVCVSHCPAHRTFNATSGLCTA
CPDNECILVTASPTHLMLRENLFTTTIVGFVGTTSLPRAPANSGQEVLDQDPIWDVVPLP
PVSLANAEVSVLDGALRLPEEGVAGVSVDATTADDSFTLGFWRSTTRFSGLTRTSNSAVA
ATDRAVAAQVGASGVLTIVAMVRLDASGYILSKTRDSLTSSIDSVSYTLSATTNNIVFSY
VYRLANGDYAQTNRAVATSVIDGTWHRLRVVIAGTDLSLWIDETPIATALQLRGPVHDNP
ANQRFVVGASPGSSLRLRGDVALVRVYPDLALTSWPSHLVQPKISVQGINLLMVVAPLDR
ETTAEFAYRLEVEYANGRRGSRELNLTVLDANDNAPQLVATRNFISLVESVAPPVILNQY
SATDADIGANALVTFANLSVLSGPEWALESDSTLPFALSANGTLSLVAPLDAESANLWRL
EVVARDGGTPFLEARAEFVVNVADVNDEPPRFLNGTNVTISVDEGAAPGGVLATVLAVDG
DISGLPVRYTSSMPAFFSVDASGHVRALIQLTYDRAAGIEGNVLTFGIVASDGAQNATLT
VYLVVRDVNTEAPTFSQPAYAAAIPENVAPGTPLDNLLIAATDYVDGAALADIQLELTGD
GANDFALLPSGQVVTFAMLDREVRDVYHLEVVARDAVDPTLALSSRANLTITLTDVNDNP
PAFTHGNLSCTVPENSAPLACVTLVAWDSDGPGNNSVVRFRLVAGDLDAFEVDALTGLVR
MRRPLDAELTSAVAVWVEAYDLGSPVRVSTRVLVTCWVENLNDNSPVLDEVTSRELSELV
PVGTIYANVTASDADVGIFGALELALHTSNPDPALSLNDDGTALIIRRVLDFETVDRQRQ
RYELFVRDGGGRNTSVSFELTVLDANDNPPVISAPDDVTLTEDNSLVPRLVATVSASDAD
SFEGDMQFLVIAPPLGFVFSRISAVSATLQAAAPLDRETLGDTLLIQLRVGDTGSPTNWV
THNLTVNLLDVSDEDVTLAPATGTVALPEEGSAIRPLANSTLTDLDVLPSTLRALRLTLP
VRDNDAWNAAPITAELCKTVQSSAGPDVASAGLVDFFDQCLPRAGTSLLTAAVEFNASNL
VVVPNALEALTGTSTALSLVLWADLLPESAGVLLSQRDADGRIQLQIYLATSALVIVTFQ
VPSLDSRPDAWLQYDVHFVPDASLLVDDGWDFIALTLHADGSASLLINEAEYAPTQITQR
EVLNGQTQPAVEVGRLVRLPDFSGMGRLTLGGFGSPAAPSSTVAGRVSALLRYVDVVVTS
RTIVCTSQCGPKLDVPAQLPPNLTLNFSASGAIVDIEGHASLAEYTALLQSVVMSQTYVE
PNPADLALTLTAWQDDDRQVDLGTRVLRPALVLDRAPIIQLTPLPQPGFASEADLTASRQ
RAVEYIEGDAAGSLLLTPNQGRVTLLDSNTAVQILQARVTLENPAAGDVLAYDVASCSGL
SPTVAPSVSTDLLFSGAASAAIYTACLRSVAFLISVPEPALPNVTRAVRFVVQQGHLSSV
ASRAFVTVVPVNDPPVVSFDGYPVAALSYQEGSGTLPLIGHARVDVLPGVVTALVHQLRL
TDADSVMLSNLTVRFDPTPAALGEQLVVRNATPGVRVDTLADGGLVLQGPASPSQLKAAF
ATIEYSNNFSAAPAVSTQLRIAASDGVAQSMEVTLEIRFLGVNNMPVIAVPSGSETVNFL
EEGAALPLFPDGLDVSDPDSDLFTDVHVHVSGLRDGDDERFVFDAALNMVPSGVGTNNTV
RMFESNASLTADALRAALAASTYQNILNEPTAGVRTIMVRLHDAEGAASNAVQLSLNVQA
VNDPATVDLDPMTGGLNRETTYLEGDARAYLANADSLTLALEQRYEYFFTAMVSGTLTSR
RSADDYVVQVYLGDGGPLTFFQSLPVTADGTWGPSDPIERPAVKYFRLVSRHNLNVPSSC
MTTECESGALALVRGDGDLEYAGLGLSLTVEDVDNDEVMGFVVTLSGADASDEIDMLHQP
SFVTREILPFDPITQTLITRFTCTSGAINHSTAAELVALLFYTNPSIHVEPQTRMAAVQV
VDSANLAGTPAMAKIAIAPANDAVPALRQDVGVIAVLENLTAGAVIANLSNLVTDADLGL
GGTVVDFFTVAGWAPNFALVDQAIVLLAPLDFEMTTTKRIQLQFTARDDFEPAGVALLTI
DLALQNLNDNPVILAPSGLLVLAMNETLLAQSPIVEFNVSDPDDLGYTLTLDQDAPGLFR
LNGRRIELAPGRRLDYETKTEHAVNLTVDDGIFTDSLHLQIQVENVNEHAPIFTLSHLSL
NMSEDQATPVSLATVRASDEDTGAFGKLSYTMEVAPNATVPFSLDAASGELTLVQQVRYH
EQASFSFHILASDGGQRTARLPVTVRVSDVNDHAPVFVAGTDNITLTVTENALAQPVQLV
VMDLDSPAHSHASFVVLSGDHSLVNISATGLVSFPRTFDYEQTPELTLVIGAFDTERPIL
GTAWATLLIVIRNVNDEPPQVTSPPWTVAEHLVASLAGVQVIDADGDENFAFSILVVSPV
AAATFVSMDADNGTIYLGDGLDFEAYEQVSIVFAVTDGVHVVNATATIRLTDVNDNAPVW
NTTALAASASELTSPGTILGQLLATDADSGSFGTVGFELLGPAVELKRFRLSATGQLQLI
TTLDYESAVEHRLSVNAIDGGGLITPAVYVLTVRNEPDESPIAPVELTFNVSETAEVGHL
LGSVLANDPDGLDSLGYALSTPTVPFAINASGVITVAEERLDYESTNKSWSFTVLVTDSH
STTRVPVTVHILDANDNSPVFESTRPVTVAEDAPAGSLISSILVSDADAGRNAALTYSIN
GSDNLPFRVQASSNASGVDLLTAGALDFETQASYNLTIVATDAGAPPRTTNHSIQVLVLD
VNDEAPVWTSANTLYVPEGAANLSSPRLVGRVTAVDPDSPDLTFAFVGGEACNASMAFAL
DSASGNISAFAALDYELGARVFVCGLEVSDGVHATVSNLTLHVTDVNDNAPVWDVNMASF
NLSEAADAGAVVATLRAKDADADGQQSVTFDLLEDEAGLFDVMEDQLILTASDVLDVDVQ
TAYSIRLRAQDDSLRPHWTDQEIIIHVLDANNRPPVVVLNTSSNTFEEGSPPLTLSHVHL
QDPDAAFQTVTRVDVTLRLSEASADSLALDLGENLTLPPAAVSAIEARVQYMATATELYL
SLRAINDARGLSLVEAATVLSQLTYVNPTDEPRLVSRSIAWRAFDGEQWSNETLMVLFIA
PRHDQVIKAALSAVTVDVLEGSLTGVLPFDAGLVLSSTENRAYNATGATVQLSAAREPNV
GDESLRLPAVLPAGLEGAYNPVAGRLNISGSASLAVYADILASVAYINNATEPLHNQRNL
TLVVYNQVGASMPVSVMIHTIRVNDPPVLGSLPTHLNFTEQSGGVLLAANVSLHDVDSTH
LSQLRVDVLNPDTAMDEAVRLNGGVDAVSGITLRSESNGTTLFLDGLGSLATYRTLLGAV
AYNANFTVPPAASKKLRLTVTDEGGASTQVVIFITFQGVNNPVQIVAMVAGTFTEEGPAV
TVLSSLSLLDLDDTELAGAELTTTFVDTAQYEQFTTLPLAATNPILLATHGDRVNLTGPA
TLAQFEAALQAIQYINRADNPSGTSRVLTLRVTDIQGGTDTASVLMPFAIVPDAPALVTN
ASQGLSAADPAPTAEDTYAARLFASEANIVVTDEDSSIVTAIEVTIMGAADPTTDRVVAS
NTDGNTAARTVDVIGTNNVVITFRVTGNWTLDDAAAFISTLRFVAERDEPTLGVRELVVV
VLDETAMRSAPLSYFVNVTPVNDHAPVASPSTQLVNELEEVEIGTRLATVLVSDADTGAF
GVVSVAIASVTFAGVDAPTNLFRLEQSNASVAVLVANGRLDRERTIITASSNDVRVDVLL
LLSDTGGVTTQASISVRLTDVNDNPPSFAAASYSVVIAEGEVGPLPDLEIRATDLDRAAN
EALTLTLIDEASLPFSSEVVPGLTASLLLSVDRALDYEAQSEWRLNVSASDGHHITFVEV
LVTVVDVDDEPPILIPQSALTVVVPENQPAPQELACFNVTDPDTPTSELIFTLASVLPSA
AANAFNLTLSPFCVHRVASLDFETTHACELTVRISNAHDDSLHDIQTIIVNVTDLNDVAP
EFDGLPVNSTLEVRENSVLNTTVLVRDPDFFAQPTVELLSPAAVNDFSAYLEPPAAPGND
WQMRLVSRQVLDFEVEAWHNLTVRVTDSGFPALSTVQPLVLQVRDVNDNAPELSSPQTAQ
IAEDAALDTLVLALSATDRDTPAVNGAPAYFFTLVDSALPFEVVSGTQLRVAGALDYENI
TEYDLELVLSDRGTPPQTRPVSMTVRVTNVNDEAPRLVGAYQNQTTVAENISSGVIATVE
AADADPPAAGGRVSLELHVSPVSLADSFVLLDGEIHLVAAVDYEAYKSVQLTVTATDTIP
PFNAATANASFELEILDINDNVPSADTYVGEVKVVESSLIGEIWFLNYTDADSAELGDVA
YELLSVTPPGLAIEVNAATGSVVVTQGLDYETDPHRFEVMLIGRDGGGRAGLPFNLTILV
QDRNDNAPQLDQVPSIVVLDLFDAVGTVVAEITASDADEVESALTFDLEGALDTPLRIDA
KGGALIVDKIQSNPLPLTQIRVLVRDGGNLTASRVLSVVSGAAPVPHLASVDGVVLRNGS
TWAPGSPPAVVRQLSTSTLSDRATTVALDASYGGVQEREILTLEASSSSVENVSTTLWSA
GVRFVVLDSDIWAERPVIRVHAQVTRTDTNSDVAIARNVSLEVTAAGQTSTLFVACQTTS
SAGSCFMAATVPSAWLDSLTAGGPDVTLPVRGGLTESGSLVEVTNVTLHTRPLPAATNRI
FVQLPAHAISPDETVRVQVYVATDRNVQNLIMSCALPTSGPLVFAETSADILPSTNVIDN
GYGFAISSLNTDGFFDEAPTGSPFLIADLQLMAGKFDALAGSTISLNCSGTMSDNEALLQ
DLPDPMGFVTDTYFEASQAAIRLQAHATIAVAAVPDTYDLTNTETLLPNTSPRVELNLHL
RSSSGLLTTLRAPVGASCSSDIDYIQVTSNCSALYFDGQEVGGSAATSILVIYGAVQSTA
TVSVFAASQVQLSASRTQLRAVAGTVTPSCNETLYQSSQLEAVARFDRGNTESAVFLDVT
NLVAPHLTVSQPSVLAVEPDGRMVVQKATLARHLIDVSVHGSRLSLEVTREGPVVAVALK
TRLITGLDVEATATTVRASLRQRRVEDLADRSGLLQSELVYADGSADILPLHAPGLAYAN
LGRDYIELINGSKVLPRSVGSGNFVNASLTRCEISLTAAPDVDVYLEPFETVLNLSGAAL
AYPNSAANRAGVPTSITVSVGAHYSSSGTAKIMTWDRQTQYTLDPASGVALRLNETEAQA
ELYVIQEATAGNFTLGVDFLDLAGNATSQLSVVTPTALEVRLRPYPAFPGSSNLPVGVLQ
RLAPLGRYLEAELSIWLKLSNGQLLDVTRNPETHLSITFANGTNASTAVELQPLGTERWR
ITPRAASSLRFAATFAEATSQSADVAQLEVSEDSTQLTSIDAFMVGDSSAVVAGQRGRSS
ALASVNVTLGNGWQLVDVTRANDGAYLGLLEFFSSNPTALAINSSTGTCAPMFNVDPTNA
VLLQARGVPTGGPTSAALSRDLRVSVNLQPAQGDVDLGDVTGHYLQNLRKQQNKVVPVWV
AVGGASLGNLTITLTYNSQRMQVVGTAIGPGFQGTIAVPSTGRLDLDLQVLNPMNVDASA
AGLLRVAEITVFPTSTRDITFGGTVQRATSTEGAPLGSPTPRTIVAGAFTADVSDTTGAR
RRRTGTGTVTSDSLTTTDVPSANATDMDQGRPVCAANATLPCTNCTGGARERGDVNGDCR
KSDADVDLLALYLEHASYNFRLPESPAVLASVYEPELDVDRDGRVTLADLNALRDLAVQP
PVYFSTLELEAPHYLDNDCELTVRLEGDKPFADRHLFLAFSASWPNFTNALSNAYVVNSM
GGDDDNDVAGLARVGDQALTPTMHPFGGVFPIVVPSNTTVARVALRADFRATFGVSVLQT
YNAAYNGVRTHARVGLRSSPLMFPNPINLPLRDAAAGINLTHFVNGFNPALVGEATTPYL
WCRNDFAPVFAQSLYDFQVNEAADPTQVALAVAATDADPGPHGRVSYKIQPDTVVDWVID
ETGVLRPTRGLDRERVAQYSVSVLAQDGASPPRITTTSVVITVQDVNDNAPRFLHFLDAP
AGGLGSVSLRLNESVAVGQVLINATAVDPDAGAAGRITYAIEGMDVAAQHFAFSATTATL
VVRDDLDFERLNVSSYTLEIIARDNATPFHESRLMVHIEIEDLNDVRPYFAPSVIQVNVS
ENLAPVHLSQVQAYDPDGKGEIVYAILQATPGTENITLNATSGSLDLLAPLDAEAGQYLG
LWIVAAERAQNGTLLFGPALQVRIFVKDVNDNAPVLAAGFSSTANVSESLSVNDTVTTVP
VIDADVGPAGTLRFSLRNSTDPRFAIDPESGRIFIRAALDFELGPNVVQLLVRATELSLS
TSYVDVMLTILIQDANDASPIFTQQEYAWQILERGGTDWQPVGYVVATDADVSPAFQATT
FSLTASPASKLFALNASTGLLLAQGLDREATANHTLVVTAQNTVPSTDGKILSSTSTIQI
EVLDINDRIPSFEASFYDVAVPENEAIGETIEQLVAFDPDAGANGTVSYSLLPDNLTAFS
IDATTGRLRVNASLDYETQQSFEFTVRATDAGTPPLYSTVPVRVQVLDLNDNAPVLVVNS
TSLLVSENNALAAPIALQVMATDADAAGSANSRVRFSVTTEVLSATTGRWALANGESLVA
VDVVTGDLRLQTVLDYEAIHRLRLVLTATDGGVPAQRSNVTIEIEVVNENDNAPVLTLVG
ACTVQENRPVHTWLPCTLVASDADGDALTFVALSGVSVAPNGSLATTASYDFESTPVTTF
DVAVTDGVHQINRTAVSLVVEDVNDLAPAFGQPSYICSVFENATANTLCVLVNASDGDEP
GTPRAAIDYTLTGTGATDFTIDRLGAVTVAATGVLNRDERAVYRLNVTATDRGSPPRSSL
TNLLISILDSNTHAPVFTSSPSVHVSEAATVGPTPVFQVVATDADLGSNALLHYSLLPGN
GAESFTLDAQTGQLFVASPLDREARDAYELVVRARDHGSPPRWTDHALQVLVEDVNDNAP
ILASGPFSCALAETDGTGGSLPVQSCVQVEATDLDVGENARLTWLVNDTRFATDTMGFIT
LQSGAVLDFETTNRVAVSVTVTDAGVPALSSTALLFVTITPVNDNAPEFTRHVFDCTVTE
NEVNASCASLSATDADANAPDNALRYGLVSDAASSAAGAVVDAESGKVRLTRTLDRETQA
EYTLNVSVHDLGMPTRWAYATLILTVDDANDNGPKFSAVPSCSLWEANGREPVGQQQACP
AVAATDDDVGWHAVIEYSLDSTFDGLFWIEPDSGIVYTNTTRQTQGGNDAGMKQLDREAQ
ATYNLTVIASNPRNVSNSDAPSARAVLTVRLRDRNDNAPLCVEQPYSCAVAEHEANLTCA
ILSNCQDADDAAGPAGQLAFALVEEPRDGQGRPMLAVDALTGVLRTTGTRIDREIDATLD
AIVNVSDGFGLHTIVPVTLRVVDRNDNAPVFDDIAYSCQLQEDADVGALCTAVRAVDADA
MPEARVSYSLVTSFGDTFTVNASSGEVRLSGTLDRETRDSYVLEVEARDAGSPQLATTTR
VTVTVLDVNDLAPAPLRTNLSCSMREDALLGTSCVLPTPLFEDGDLAGSPASQLTFSLEG
ESATMFSVDNETGVLTLQRLLDFETEAFLTLTLVATDHGQPRLSGRASVAVNVIDVNDNA
PVFASPNPVCVLSESAALGTRCAVVRVTDSDAPGTAHSNISYRLAAATADHFRVDARTGQ
LILRSLLDREALDRLAVTVEACDGGLPVLCANATYDVTVTDENDNVPELINRPSAGYACQ
LPENTATESACVSLVAQDADAGDNGRLTFALVDDFGGRFRMGANGTLTVARALDRERQSV
YALDVQVSDLGTSPLSTFARVTVYVQDVNDNAPQTQAALYQCTLTENALVGSRCAVVQAT
DADTGVNAALSFALAPNTTRGRAHPFVVDATTGEVSLGPGGLDYETFNAYELLLSVTDGG
SPSLSSSVLLYVTVADVNDNVPIFTKTSYSCGISEVAGNPSLVLDLGPIECVQVAATDAD
APATPASTIRFSLVANAAGLFSIDANSGLIRSTTSRFDREAEAEYMLRVRAVDQGVPPLA
TEVTVTVRIKDVNDHAPVVTTPFAEVDVSNVLQPNDLVLKLTAQDADAGLNAALRFVLNS
SSSSHFTLDTSGSLYYTGGPLEDLVNDRAEMTYLVHDQGVPARSAAGVVHVHVRPLLRAL
GATMVALDWEVAFDSLGITAGAQVQRRAAVSCGLDYPATRSCNTSIVTVFAGQAHTYVDT
DVRAATRYEYRVLLGDAFVSAWYTVETPESAPAPVRSLLAQQLNQTAARFAWGRPTPSNG
VITMYELVLQATERFETTTAEDGSLNRRAAASEITPLAGRVIVYNGSSLEVVVDALSPNY
AFSCFVRARTAAGSTNGVVIMYEPQPLATTTTVAGDQLGSSSSDSALSSAELIAIIAVPL
LLLFLILLLVFMLLRRRRDSVSVKPGHDGLGDLQMSTLDRPADSFGLRHPNALFLQQQDL
YNSTATDVTLTETRVDMRAEHSRGELAFGEPAAMLPTPLQDGPPASLESTRSTSPVNEAS
AISVKGGEAAAERLRVMSTGMRRDLRLQSLDGNPRSHHLTLTTFAAPAVPEPEPVVNPLS
PAAAPYVLDLANLEATDGFAMGTLWTFADVQKEVERLCEDSAKGMTAMFRQAEDLAADAR
VTVASAPALASRNRYADVLPYDHNLVVAEPEHGVAYINANWVAGYQDEEQYICAQTPMPA
TIRSFWCAVLRHRVAVVATMMEDARNQYWPERLHKPMLLGEGYTVTLLSQDIKEPDAWCT
RAFRVAHADGRNHVVHQLQLLNCEPAKVLAPTLARFALSCELQRDASGAGPLLVHDDVGA
GLSGILLHTLVCVSMGLDTGRVDPARVLIRLLEQRRAMLQAPVQLRLSCEALAYVAWIAG
RLRRHDLVRAPEDKPIAEFVTTMHYASTHDHAKAASPGSGVRETLPAYEDHAPIAITSAS
MVGNDRDHLRVSNPHGEPAAQGTESSTVYDQPRASDVVYANVELQESAEPLYGEVAPMNE
REEYPVDSMALDAAATDVTQWIEHLSASGAFEDTAL
Download sequence
Identical sequences A9VDP0
81824.JGI30335 XP_001750851.1.20067 jgi|Monbr1|30335|fgenesh2_pg.scaffold_48000016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]