SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Monbr1|32450|estExt_fgenesh2_pg.C_100142 from Monosiga brevicollis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Monbr1|32450|estExt_fgenesh2_pg.C_100142
Domain Number 1 Region: 31-182,245-260
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000000000000131
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.023
Further Details:      
 
Domain Number 2 Region: 243-386
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000000000000889
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Monbr1|32450|estExt_fgenesh2_pg.C_100142
Sequence length 398
Sequence
MLLRIAAVLALTALALGQEGKWEIISNPGLTINIGITFKNEDEGFLAGAVNGLGNEILHT
VDGGHTWNSTQGNLNNDLLLFDCECSENTVIVTAVFNELYSKDDGRTFNDSLGGGHSQSI
RYISTDNDGERFGCANSFFGYGGAAITHDGGVLFEQRPAPELFTFARYGAYPSENTWYIT
AGEFPQQEQDDDQDDLPAALRARLPGDKMAARGRKSVFQDEFGRWRKDLGAHRLQNTTGS
YKAQLIKTVDGGKTWKTQFAQNDTFYFNGIDCTSETHCCAVGESMDLPFDGAGIWCTHDG
ETWNRTFYSQDSNIGGFSLIDIRFANENLGWAVGGELGELAPKAYFVETRDGGKTWDPYA
HVFWGYYGLGIEVVNEKVAYAALDDTVTQQSGVAKWTA
Download sequence
Identical sequences A9UZK5
XP_001745961.1.20067 81824.JGI32450 jgi|Monbr1|32450|estExt_fgenesh2_pg.C_100142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]