SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Monbr1|34392|estExt_fgenesh2_pg.C_350079 from Monosiga brevicollis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Monbr1|34392|estExt_fgenesh2_pg.C_350079
Domain Number 1 Region: 411-444,471-625
Classification Level Classification E-value
Superfamily Sialidases 0.000000000275
Family Sialidases (neuraminidases) 0.045
Further Details:      
 
Domain Number 2 Region: 113-330
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000000288
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Monbr1|34392|estExt_fgenesh2_pg.C_350079
Sequence length 1006
Sequence
MTSPTWAAPWAMATAVVVAALGLASLASAMPMQVEHLDASAHQIKVDLVDGHGDREHRQL
VIQLPDVMPADQGKSTSKQQAQAQPQRRDVQADAATDGPTIHSNTLDDLYGNAILAFPNN
QSDLFVMVTQFYSLGSVVASHVYFSTDLGRNVTRAPKFEAFGAITNVFVSTTSHNTIFFE
LEDSEEFLITDDGGQSIRAFLNVTNRALLDSTVQYGRIGWAQNGMLYISSDMGLTSTLIN
DDGELIYIFGNVHPQTGNVPEYLAFLAIVDSEVVVMTYDYETGTQTNIATQLTHDLTILT
STLSTPENLIYVYVRDSNLNYGLAISIDGGDLHAVTFDNNPGISGLQVLSYVDQVLLVRV
QDFAGINYLYVLDVGGMEDASAPIARRTLAGLRCSISTCDVVGSYAVRGLFLANIVRNGN
FYTFKTEDFGENWEILSVVSESCPAGSTSAACRLHLHMAVGTATMGLSFSATRGWLAVPH
MMVGLGNTGTTLAPASRATVAVFISSDGGQTFIEAAEEIKQPLPADFGGVLALTDIYDTQ
SAGSTTFQYSLDEGANFTTVAFSDAAVHVVGTLAHQDMSTPLIMMVGYERTPANNDYRWQ
VHVLDFTPVFPRVCADADFQRVPVRDGVSTACVAGATESFVRRKPEAICLQSREHDVDFQ
AIPCECQPADVLCGDHFVNKSGVCEPTAQACAALPLPIYQHAEGNSCEGGLLDEMLTICT
GVSTAATTTVSTLGPTTNTMSTSTPVTATPSASTTALSSSSFASASATQVSTTTTTTTTT
TTTTTTTTTTSTTPSGSSTSTINGQNPNADASLNDGGNSNSGSNQSTLYVVIGVVLGLAF
LVLLVVAYRRRERDDPVYAANYGNVTGFVNPMHDLDNPPTGPAVGMGSRTVQANPIYDNA
QQQAMHGKPITNAGYMDVAGSWDKSGEYVAFANDLGEEDGAYMKVGTPHDADDVDGAYAM
VTPGVGLPGALDSFDDDDDNDAGYMHVTNEDEGEDDGLYADARITK
Download sequence
Identical sequences A9VBD6
81824.JGI34392 jgi|Monbr1|34392|estExt_fgenesh2_pg.C_350079 XP_001749994.1.20067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]