SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Monbr1|34471|estExt_fgenesh2_pg.C_380013 from Monosiga brevicollis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Monbr1|34471|estExt_fgenesh2_pg.C_380013
Domain Number 1 Region: 180-253,394-445,552-769
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 2.51e-20
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.017
Further Details:      
 
Domain Number 2 Region: 499-579
Classification Level Classification E-value
Superfamily PA domain 0.000000000000106
Family PA domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Monbr1|34471|estExt_fgenesh2_pg.C_380013
Sequence length 1066
Sequence
MARVGASRASRTGLAVGLALLGVLCMAMTVTSTAASQRREFLAQRRQILARPKTSTRRQY
LSLGPDGNVSRAPQREAHWHQLQEHLKAHHQRPITDAPSGVKRSTPLRPEDLLPLPSTSG
PTAESFPIPAELRRRRAASDNAACTNVDMTSVSERVSQATDSYTFEATGGLYLNWLGAPY
EGIMAWLEFGSSTTQGNAYCSSDMGKTFAACSGITLDIADFVSIEPPNNKKMAGGLLVYA
LPVTGKFIFVASDDLQFTKKSVNEAYDRILLHPTDQTQLLGFVKASLNGVESDTMYHLKY
SNGEFSETQLETHVHFAEWLQPQFILESDESDVILMTQYQPEADTSSGQESDADVPIHFV
RIENPSSSTPHRVTLKENCHEFTQSDSFLFVKETPGTFGEQTLHVSSDNGKTFTETVFPT
SGKSLNYYVTETGEGEALVVSEAQITGFYGNLSITIQGTSTVLQAARLKESPLVETALTG
KVVKPASNPTGCADSGGIGTSVAGFIVLVQRGDCTFAEKVRLAEDAGAAALIIYDTASDY
IGGVYGLDKADATPTIPAMLVGKNAGQVLWNKAGTDGQSTLSVTLVEEDVSEQSLYRETV
LYISDATGVYYTVALPDILYFPATEESDEVVDLHAVQSQRGTLIANVLDQGSYVSLISYN
KGALWSKIPVPENSRSRCEGSNECNLHVTLEIWQALYGVPLPSSRANAPGIVMVNGFVGA
ALADTYDSNVYLSRNGGFTWDEMFGKPHLYEILNYGALLVAIPYLQSSTISYSMLDGRED
EWATLKIAESDVWLYFATEPSHRESAVSLFYQNDDYYWVTKTVDMADASVPYFFDYILTP
SFDCFLGLDADFYTETVPNTGTTKDVCLLGGLYSHLRRSSCALCSIDVDQDVHTLTLEHS
CACSREDYQCLAYGGISFGLSTSPALIRRSTSQPEESTTMVSSYAKIAGDVCEESSLSKQ
YEAASVELTCTSHKKRHLSAGAGFAVALAVLICLVVLIAGTFYCSPRARSLYQQLEAGLN
GDTSLGPLDSDDDMLIGEEDALEGPIRPIGGNAHFDDDDDEDDFFK
Download sequence
Identical sequences A9VBY9
81824.JGI34471 XP_001750228.1.20067 jgi|Monbr1|34471|estExt_fgenesh2_pg.C_380013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]