SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Monbr1|38017|estExt_fgenesh1_pg.C_190054 from Monosiga brevicollis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Monbr1|38017|estExt_fgenesh1_pg.C_190054
Domain Number 1 Region: 237-382
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000000000000549
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.014
Further Details:      
 
Domain Number 2 Region: 35-180
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000000000136
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Monbr1|38017|estExt_fgenesh1_pg.C_190054
Sequence length 396
Sequence
MKATICVLATAVALATATPGWNLVAENLLTTELGIGFHSETEGFIAGDANGEGPAILKST
DGGKTWNASQADFGADALLLALGVADDTVIVTSIFGELYSNDDGDTFERGLGGGLSQSVR
YLGKDGDGGSKFGCAGQYRGHQGIALTTDGGKLWKPVFADKLFTAARYAAFPSDSVWYIA
AGEWPESASDDQPASNDDMPTRSPRLRRSDFQDADGYFPSTFSFRETRRVEADNGYKAQI
VKSTDGGKTWVTQFAQNGTFYFNGIDCTSEDHCCAVGESSDPPFLGAGIWCTQDGTNWNR
TFYAPYQSDPTVGFSLLDIRWASETVGWAIGGELNSLAPKAWFVKTTDGGKTWDPLSHQI
FGYYAMGLDVVNENVAYAAVDNLLTQTSGVAKFTSQ
Download sequence
Identical sequences A9V575
XP_001747839.1.20067 81824.JGI38017 jgi|Monbr1|38017|estExt_fgenesh1_pg.C_190054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]