SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Monbr1|6041|fgenesh1_pg.scaffold_3000539 from Monosiga brevicollis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Monbr1|6041|fgenesh1_pg.scaffold_3000539
Domain Number - Region: 305-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000123
Family Laminin-type module 0.036
Further Details:      
 
Domain Number - Region: 105-212
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000323
Family APC10-like 0.039
Further Details:      
 
Domain Number - Region: 598-651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0105
Family Laminin-type module 0.029
Further Details:      
 
Domain Number - Region: 2410-2483
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0235
Family Type I dockerin domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Monbr1|6041|fgenesh1_pg.scaffold_3000539
Sequence length 2964
Sequence
MDGCLSAGVCLFVLLALQADLVYSSLLLPPQAGSLRHGARAIATETCGARSSSESAVPPY
NLLEHDALDYAQQHHSSTPPAFAPVDENVCLVAGLTQLTYSCGHSCSLAHPDTFHPPSHI
LDGDLSSFWQGPPGMDDINVTISLDPNSAESSFQYHLAYVLIRFNSPKPAAMVIERSTDG
GHSFTPWRYMARDCQGTSQAFCFLPPYPVHRLPFAFTFVPVRQTGPRLMPRRDPSLGLTS
DYRSLEVDAVRAFVTADHIRLRLLQLHRFVVSTSVQSGINCERCLSGFFRPEGVSRHAPT
PCSACNCVRAGASNQETGQCTCREGMTGQHCDQCATGYTPVSTNATTSLPCAGCTCLPGA
SASSVCAPNGTCSCRGHYIQGHSCDHCSAGTFAPVVATSLYQIEDAINAASVIQRIVPSN
PNATMQYSGLGLAFVRSHLPIHVALPLTASSGSHTLVLRHASQASALVRIEFNDFAIAAR
TTNLAPCLNDDFCDTILADALEFTIQGSVLITLVCNAEMGSFCAWDALALVPRAVVAMEA
ALEPAVAPAVAAITATASLRTTHRCSALAYPLNQVDAAQCARGARAAALSAAGDCQDCDC
HTLGAVSPICDEAQGACTCRPGVANDRRCLPGVAGPRCDQCVATAINLIPFVGCATCNAC
SQHLRDLWHNASNALGNVNMTAMMGLDAVRSDLVAAQAARESALTSLTVTAQELSTLATT
VDAGNSTLRRAVTTWQAPAFVTMILATDRLRLSLEALGGHQAQTAWEVAHTAATLETLAA
QWAALFAEASNSLNRSALATAQTKFDRALHAEVQARAFPLAVSGLHRQLAQVQAQRGLIQ
IALDNATTDSADAFASLNHSTLGIATLVDRFEASRLQISDTFAHISRLQEHHIASVEALV
QVQGSLNNTTNLLSEVEAEAAALRIDGASMQVRLNNSAHLLDKAIPAAAVTLDAAVDALD
AQAIQTHNLSRVAASDVDQTERTVAAMGEWLVALAPPVNPDNAVLANHSAADLATLVAAN
RAANATTRAAQSQVAHLPLLKEFDEAVLQADVSRLNNASAVLSGLNEAAATLNTSLFLAA
EAGIDPFAEVTRLTSRTTAGFAAIATAAQNATDQMNMSCAWTSLNTSTPIVLLANLTRGT
DGLAVDASQLVHTSKTLASELESRLHVVPTFNATAALQTRLATTSERLANLAARMAAAHQ
RLLQAQPPSWPDIQLELGPSAALLLASNNSRAIQVESVDLMPASPGGHAGDVLTLPVPIR
ATGHVPVIRELMLSGSLAPLDLRLACHWAAPVVAAHSAVDKITLIGHAYHPAATSLVMRP
LAMQVGGVELQTCRLDNDGLCVFQLTPVELTAALSATVGADPSTWANMSHPDRREVVVTP
DLIDTLSGQKIACPPLRLSHDVTQPGFPVSEAAQLSLTTPLQPARAGDVVAVQIGAHAWS
HGPITLSGALDVPCVLQLRDAQLATGWTGTSRFVRNSTHCWVVFSARQTTAATASSTITR
QIIHVLDLLRVALTVSKPMDAASSVPLPLALHLWTASDGGGALAPLSSYCTSTNCNIRVL
DTELADATSLLIPVPSHYALLNDGALQHQPRRLSLRLRALTTDGRTTNMSTEAMTCTAHP
AAAVQAASCAEVVLWPDTLSDSFDLQLTATTRLATGDFGRNVTVQVRVHQPQNVSLVPDR
GFSRPIWGWRSDDTCTNGARRAPQRLRILAHVDGMMVDVTHRCSLADCLPDAAAWRSGPH
VWTATVQSNLTLALRQGNSLWTSVVSRSILPVPATILGLNMALITPSVVEAAFSARGEAA
QQWDLSASLPPSPYSTVLRDNETTATLAPYLVLQDWSIVPLSMHQLETTVSSSALAVLAT
RNLSIEARVPVAMAQTATLTVALMQPVPCGGIVASTNAVNLSVAPARAVALQVIAYDLDS
GVEAPMDSTSIVTVPGDLLVSFGTAISRCFRVQLLYDGGRPASDASALVSIAFNASALRR
SGTSLCFSGVSTGQHTVHFVHTDAPLLRASHTVHVVASTGLSLRMVHWPATQSDPHLESE
ATTLAPAGVDRTGRRVYESAMLLCVANLSNGSTLALSPGPATDALAFGGIAAGELGMTTY
DNRARLSFQHEPTYGYRGHVVTPEAPGLVSFAYFLGVSMSNIAQTRVSSSPRAVVAVHGA
SVSPAQQVVFDHVLFAEGVLLPHTFFVRDGTALLPQLLSFRSHEPEVVGVNAETGHCQVM
SPRAGSVQVDIQFRGSPFASVQVPALGAPPQRGLWIGSTNDMTTNRVTVPLWLYMDEELS
AGTILRFVLSASCEALANASARVGQAGAWLEFALRDCELEVVVIVADAGTVLEMAWVELD
AAAHAALHAEVLELVGPGLLSRTYTNVLNSSLQLEAATLARRPRDVSCTPYDIITRNECN
GAAAASCPVDVWGDANGDCELDLRDLAALVFRSTPLQQMVLPTTHLSGLQQLNKLFNAAS
LDFNGDGALNQPDTRLWAQAYLGLPIVAAVNWQVEHNRTPTTCSVALVIETRSWDGGLAA
ELSLHVAGSNLLHMASPLLLPGHADNGSSSWVYGGTLPGPRTRVQFTMAAGSSIRAYLLS
SSTVALFSPHVERPAYVFECLTATATQPLPLNSTATSTATSTSTSTSTFTSTSTSTSSTS
TSSSSRSEPMASITSSSFTTTDNMATPGTTSETAAPTAPSLPGFSITFDSETDRRRFSTA
FTPEKYEAELKQVSLEACCAACETSAICRGAFFWLTKAGETRCHLLSDLGTPDGVSTESN
SLSLTRKTWRGCEVAHQGVLTVPGLTNVSHTPRRFATAFVATALLEELYDLDQSGCEAAC
LRRNSCTGAFFWLVGARARCKLLADVGEAGVATSSHSTSLQCRAQFDFDPRWTPSGTLLR
ASGSQPLGESLRFGNAFQTDAQLDVLRDGRTVEECTQACTHHGLCAAIFHYLPPGSGMPH
CVLLERAEDVVATNLVSLSLELSH
Download sequence
Identical sequences A9URE3
jgi|Monbr1|6041|fgenesh1_pg.scaffold_3000539 81824.JGI6041 XP_001743515.1.20067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]