SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Monbr1|6820|fgenesh1_pg.scaffold_5000240 from Monosiga brevicollis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Monbr1|6820|fgenesh1_pg.scaffold_5000240
Domain Number - Region: 1201-1265
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0153
Family Type I dockerin domain 0.0097
Further Details:      
 
Domain Number - Region: 627-714
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0189
Family Fibronectin type III 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Monbr1|6820|fgenesh1_pg.scaffold_5000240
Sequence length 1790
Sequence
MAPNQSIGALLTMIVVSGPLMLPIQAQVIETCVGRPVGQPCAFEPCVAGICFFETCVAQA
TRTDATPCNTTSDDPSAGFTAQLGVCYGGQCFINDTRTDRPSIGLGHGPRLTAGPSYIVN
SAGQALIFASNLSDAHMEFPGWYPGSTLAVGDLLWRTAQLRVLVTQVARDLVSPRGVLQL
SVVPCDPNVQDSPHWATLAQAHKLCLSAPDRNASCAILHCPLSAGASQPRVCLASFAASA
WRSTDTLGPSIPMVFERREHANARAHLDATTTCEPTSSQSSSDLRLPRVPRPLDALGDNE
LEARLYRNATALGLPQLYTLHLASRLALRDASLRLTQVPKCGCFAGPGANTTAHDTEACA
STLQLVFGTVSPDLALPFTYTGQDTCHLALHISGTRPDGSRHEQPILVASDWSNLSSTVP
VPSSSAFASMYAEVLQPPALCLNASAPLHLTTLTLVGPDTNPQREKIICSASAAFGSCKL
GGTVRMVQFEDAALRIGQHIVPRVLGQPNITLTSNAHAWGGTSDWFLSEHGIQSCAPMIG
PPITMTAHANASTSTSHSLLLLPVTALSDEWRAVNWTMPAPHGPGHIIGLPASLSWQTLE
VFHLTSWMATARWPARFEVLAIPFVLVPNTTLGPSWDSMPDSLSNLAVTTLQPGRNYVLL
LQGIDRAGASMPLDPMHLKLRTLRGTLSADRGMPEFRAPLQGSATIVAQWQPPSCAFPLL
ERTVLLPVADDPVDVAVSTLPSLLTAPADADLFVLVGAADVASRLQLRMSTPIPGLELDP
AEASLDVHARAMGFTLVNGSLTIAQNTQVMGNHSLRLTLADDVEAILDVTIVRATELQCG
LVWLDDRRPVGTRYLTSVARTNWQPLCLECTMIDSRSHTHVVTAGLNASTTNLVPWKTAA
DDRLCFTLQNSSNDAVHLAVSLLALHEGVTLPLIDSTSVVQGVVALSSNGPAVVRGLPNA
TVALPAVLVLENGARLPATPATLARFNLTLAVPVNDQGLTVMRAAPPVFSTLHVRGTSCN
STVSVMGPSINASLSLAVEVDGESGDLHWTDDGQLGLHTWWSANQSVIRPSGLAVAVQVV
GQSDFVQQVRGFDGCLTSLNVQFGTPAVVTLFVICHEPSLWNEDSFLLAQINNGNLAEAF
DTTLLSLDVWWSNGSFTTKVSTPRPMPAASRACGNAAHSNWTKAYEARQIPKKSSSWAAL
DVTGDGGFDIRDAAQVLRLALEGTSATTAYLRNMGPDACLRCLDSTADGRVTIEDARLLL
QVLAGRAFVPTLLTQSCPGAVGVNKTTSNSSASTGLANSTGENINEGATEISQAKAVSAT
RLSLAGWQAPLAHPFFWVVRLSNGSFDLWASQTELVDASPLATRMSAASVEEVAIIWPAD
DRGQLLALQSGAGTVNMYEPHLSVPLQASTNSTPSVASVAAPLIENLDPCVPEGLPMAMS
DDGAVPQMESYATSFGFGALSIWLQWTEAPVLEIHLSASTKWKSQTLAGQTLVLACANAS
SCDLCWRFGDAVGNSLETCRVIVANWTFADPTGQFWHHVFFGVWGDELWWAVDGQLLWRS
RRILLALQQLPTPFTEHNVSVSGLTPPRTQAVAAGLPQNRTQMPELLAAACMCSRPTINM
LNLTLRLPSGTARACDHERQSFVQQLVVIVASILLLPDRDVVLNNLSCTASEVDAALLVR
TAPNHNITGLDVHCSQLFAFELFIDEWQIACLCPIGTCPQSADCHASRHGSFECTQPVTT
KMVSTAAGSFADNAEQRRESSAWPAVLIALLLGLLSVMFTALITYVAGIS
Download sequence
Identical sequences A9UUC3
jgi|Monbr1|6820|fgenesh1_pg.scaffold_5000240 XP_001744367.1.20067 81824.JGI6820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]