SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Monbr1|23774|fgenesh2_pg.scaffold_5000037 from Monosiga brevicollis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Monbr1|23774|fgenesh2_pg.scaffold_5000037
Domain Number 1 Region: 236-316
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000799
Family Third domain of FERM 0.0062
Further Details:      
 
Domain Number 2 Region: 397-456
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000021
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 3 Region: 127-217
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000589
Family Second domain of FERM 0.0021
Further Details:      
 
Domain Number 4 Region: 17-108
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000633
Family First domain of FERM 0.074
Further Details:      
 
Domain Number 5 Region: 466-523
Classification Level Classification E-value
Superfamily SH3-domain 0.0000381
Family SH3-domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Monbr1|23774|fgenesh2_pg.scaffold_5000037
Sequence length 528
Sequence
MLQSFLGLKGAPELVAVTLALPDGAAVTVEVSKNATISDVLPLLDREVQLPERLFFGLLA
PKDTEKHFLDPNDSLRKVLGQPVAEVETTTGRLGRKHWRLQLQLRYHPPAVVMREWSPMG
KTWLLHSLLAELLAARLQVMQDVAVSLGALAAQVLAGDYEESRHADAQYLRSMRVQPDQD
ERLTRAIQHRHASHSGMITSANALDEFLNLCCEQELYGVGRLFETAPTPDREIQQVGCSA
RGVHVYAHDQRVVIYGWSRIQRMHYRSKNFEITLKTPPSEFEPTDFFFATSALCKAVWSH
CVERHAFYRIRNTSLRGDVQGVPIGATMFEASRIARRNSKMLEQASLDEARRRSSNWTSS
TGSFESHVSLDSLIRGAEGEAIRRASAAPSKNVARTPSFAVAIVAFEPQGDRDLAFRPGQ
VVRLTKTDEHDWWWGAIGPQSGRFPSRCVTRLDQDLSRLVKAKRDHQGEMSFPAGAILSL
EETSRDVPAGMLFGRFGSRTGLFPQDVVASLAPTTKPLSQPLTQQVII
Download sequence
Identical sequences A9UUT1
XP_001744071.1.20067 81824.JGI23774 jgi|Monbr1|23774|fgenesh2_pg.scaffold_5000037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]