SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Monbr1|25524|fgenesh2_pg.scaffold_10000174 from Monosiga brevicollis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Monbr1|25524|fgenesh2_pg.scaffold_10000174
Domain Number 1 Region: 79-189
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000301
Family Collagen-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Monbr1|25524|fgenesh2_pg.scaffold_10000174
Sequence length 318
Sequence
MMRLALALVLLAASTAGVPLQRREASPSPVTIDASGDSQLLASTVAPTTTTTTTTTTTTT
TTTTTTTTSTVHMCAQDDAYEPNDTYNWAAILPIPSVSNLRLCDTGDYFRITVCNGATVS
VHLTFNSSNGDLDMAIYDSPNGVLLDSSATSGNEESITFVNDSPGVGTTEFVIRVLSLSN
HINAYTLNVSLDDECNEPTTVVPTTTELEITTPDLSTPVCPDNFIIRTYARDRTFDVTFT
VSCPYGHIVRFCNDRDDDAVELILFDDQVVASDYTHLQYYVPPEVAIEGKHYSLLVWSSR
RTAIEIYGHLLISECVTQ
Download sequence
Identical sequences A9UZN7
81824.JGI25524 XP_001745975.1.20067 jgi|Monbr1|25524|fgenesh2_pg.scaffold_10000174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]