SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Monbr1|28326|fgenesh2_pg.scaffold_25000078 from Monosiga brevicollis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Monbr1|28326|fgenesh2_pg.scaffold_25000078
Domain Number 1 Region: 280-498
Classification Level Classification E-value
Superfamily SIS domain 0.00000000000939
Family mono-SIS domain 0.0014
Further Details:      
 
Domain Number 2 Region: 53-144
Classification Level Classification E-value
Superfamily SIS domain 0.00000136
Family mono-SIS domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Monbr1|28326|fgenesh2_pg.scaffold_25000078
Sequence length 579
Sequence
MTADVCDQLGPLGIARLLRQTDGQLFAGWREHAGIFDLDIQTRLQALSEIAEEKLLGIIL
KGEPHRFVFTGCGTSGRIAWLCARAFNRILRAHHPDVGVCFQYCISGGDESLVISNELPE
DDPHAGTADVKRATKDAADVMVNILTAPTIDMVNGGRSNFTTCLIGFNPVDRARDAPVEN
WDRTCHQVFNELERRSLEDDDGLSWVLNPIVGPEPITGSSRMKGGSMTHILLNAIFLPAL
HNIMADVIPAPKHDLRLHSPTDAVMYFERVARQVHLACDDVASLVSLAGQALRHRRNNHL
YYVGIGTAGLMGLIDASEMVDTYGCRDDEVRAFIQAGWAACGNVEGDISGKGPAFCLNTD
EFERDILPTLTERDTVIVLSLDEPAVQADDTQLLVRKLVSSPAKLGCVHIGRSNLPPSHL
GANVDEFEATCIAQCDELDIGNEPIFAMFGLKLILNVITTGANILRGAVHGNTMINVTVS
NNKLFYRAAEIVANLAHCSEESGQVALLKAIYQTDEVDEAITSLPLSEHIKKATPMKFIV
PTASLMASGKLSLASANKHLQSNHTPLRQILALAMAKAE
Download sequence
Identical sequences A9V7U7
jgi|Monbr1|28326|fgenesh2_pg.scaffold_25000078 XP_001748756.1.20067 81824.JGI28326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]