SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Monbr1|34615|estExt_fgenesh2_pg.C_420036 from Monosiga brevicollis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Monbr1|34615|estExt_fgenesh2_pg.C_420036
Domain Number 1 Region: 451-781
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 4.97e-37
Family Oxysterol-binding protein 0.0046
Further Details:      
 
Domain Number 2 Region: 178-305
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000185
Family Pleckstrin-homology domain (PH domain) 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Monbr1|34615|estExt_fgenesh2_pg.C_420036
Sequence length 939
Sequence
MVEPNPGICSLTVASLLSSASTSSLLLLGLTATRRSGQYRRTVAMSDKAEGLAAPSGGAS
ADTTPVPAPAAATPKAPEGNHSPGSDRGIAVPKSRLAPPAFGGSAPTSLSHTLSSYDDED
GISFISALEHEMPNSPTNDSNHLKYSSSRDSRKQYKLNRSRYEEEKQRMTDMSGYDMDER
PYKTGIMKIRNTLRSWTKFYCELRHGMLLLYKEDRHDVWMGTVLLAGGMVMERPSRKEGH
TFKFSHPLRAAIHAPRGPKGEIWFNLVRIPSDHCMFRVSTAQECEEWITAFRRSIFGPHP
KYESRMAEPVISNFDTLRADVQSDDGLCASQHDLHHAHEASPRSNRRPMQAGENGLSSAT
RQQLEAQGQAAALAAESDLDHGEDLIPNWRADARDFTEPAPPIEVEENAWELHLSSLQHS
PGQRIQEQQFTEEEVATVFERMGKVPVTEAVTLPAFMLEPRSELERLGDAFHHADILTDA
AKHAMPRGRFVSVLRWYLSSFYAKASGALRPIPPCKGEVCRLMFEHPIHGSTPSSRVFFV
AEAVEHGCAALHGSSRVAGWAVDGVINCSHHFTGDKLVSIERGQMEVHLARVAETFVMTR
PAQVTSGLSTGHTLTTYNGSIELRCDMSGYRFKGSFDPNNQLSNVIEGTLFHNEEKIATL
HGEWDGQVHIKTLDNDMHLLLDTADEEIEARRLTRRAIVAEELWGLPAVEDQPFTDSQAL
WSSCAELSGEDFENYIASLRTRMLAAHAPTLFHITNGQYRYTEDVGRPWDYLRDLYDYQS
EGHLKCLTIQDTVTGTPRSSTLTPVQTLRNRKRPNSLSGLASVSTMDSDVFVASPRVGKS
GGGRTNLASVVEEAGSGTPQGETNASEAPAATRRTPSVTVKSSPSANAATPAGAAGKTPS
AEGLAQVTKRVARLESAFMMERALLVVVLAILLGISVYF
Download sequence
Identical sequences A9VCW0
XP_001750540.1.20067 jgi|Monbr1|34615|estExt_fgenesh2_pg.C_420036 81824.JGI34615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]