SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Monbr1|34933|estExt_fgenesh2_pm.C_30055 from Monosiga brevicollis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Monbr1|34933|estExt_fgenesh2_pm.C_30055
Domain Number 1 Region: 137-446
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.93e-101
Family Protein kinases, catalytic subunit 0.00000000241
Further Details:      
 
Domain Number 2 Region: 5-108
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-18
Family Pleckstrin-homology domain (PH domain) 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Monbr1|34933|estExt_fgenesh2_pm.C_30055
Sequence length 463
Sequence
MASEDVVIKQGWLLKRGEYIRNWRPRWFQLKSDGSFRGFKTGPPQPGDGPVNFFDLAGST
LAKTDDGKPPGSKGKKYGFMIRFMQMTRFVERSFHLESEEERDEWVKAYEVVKSKLQDTV
AKRVEASGGQPLSTRDVTIDDFDMLKVLGKGTFGKVMLAKDKSDGELYAIKVLKKEVILE
KEEVEHTMTENTVLQSTNHPFLTTLKYSFQTNELLCFVLEYVNGGELFFHLSREKVFEEE
RARFYAAEICLAVGYLHAHNIIYRDLKLENLLLDKAGHIKITDFGLCKEEMSYGTTTTTF
CGTPEYLAPEILEDNDYGRAVDWWGLGVVMYEMMCGHLPFYNRNHEVLFDLILHEEIRLP
DNLSPAAKDILSKMLDKNPLTRLGGGQRDMEEIKEHPFFESIDWEKLYNRELPVPFKPQV
KDETDVSNFDPMFTAEPAQVSPTEASTLNDEAAFANFEAGPKA
Download sequence
Identical sequences A9UST6
XP_001743446.1.20067 81824.JGI34933 jgi|Monbr1|34933|estExt_fgenesh2_pm.C_30055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]