SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Monbr1|36983|estExt_fgenesh1_pg.C_90154 from Monosiga brevicollis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Monbr1|36983|estExt_fgenesh1_pg.C_90154
Domain Number 1 Region: 229-314
Classification Level Classification E-value
Superfamily SH2 domain 6.22e-38
Family SH2 domain 0.0000253
Further Details:      
 
Domain Number 2 Region: 320-404
Classification Level Classification E-value
Superfamily RING/U-box 1.7e-28
Family RING finger domain, C3HC4 0.00031
Further Details:      
 
Domain Number 3 Region: 40-155
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 2.35e-26
Family N-terminal domain of cbl (N-cbl) 0.0000894
Further Details:      
 
Domain Number 4 Region: 486-530
Classification Level Classification E-value
Superfamily UBA-like 0.00000000574
Family UBA domain 0.011
Further Details:      
 
Domain Number 5 Region: 165-226
Classification Level Classification E-value
Superfamily EF-hand 0.000000326
Family EF-hand modules in multidomain proteins 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Monbr1|36983|estExt_fgenesh1_pg.C_90154
Sequence length 533
Sequence
MAQRTSSISQSAAKAKQWIRSKLKRDEAEASPFAHWQNTIDTKTLLRIDKNTERLITLCQ
NPRLNLKNSPPFLQGILFDTREHLHALFERNPLEALRQNAFVSIFLIKFLSHCKRASNLF
KEAGDRMEDEQSEDRRELNRLTLVFSHMLADFKSLTQDAKLDADFLIVKIGAREFWNAAF
PHRSIVPWGEFLHQLKKVHEIGEPEEAALKKTMPWKQLINNWSLIAIRHPAYQAFITYDE
VEATLSNHRHKPGSYVFRLSCTRLGQWAIGFVAKDGQIVQTIPQSKSLYQALIDGAEQGT
FLYPNGEDANPDIAQQISVTPQERIKVTQEQYDIYCQIDTTFEVCKICNSNFKSVRIDPC
GHLLCHQCLRKWIDSSNTPTSSATTCPFCRKQVLSTESVTIQPFNPFGEDDDEVDLDGDL
EGLYDNSEVDNDLEDVDAVIAQASIAAPPPRPASAGVPIHHRRPPPVPSASQGTPPRRTV
STGDQRVAGVAPDEVLLLELQNMGFEREAAAKALRISRNSLEVATDILLQFPA
Download sequence
Identical sequences A9UYU0
jgi|Monbr1|36983|estExt_fgenesh1_pg.C_90154 XP_001745549.1.20067 81824.JGI36983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]