SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Monbr1|37785|estExt_fgenesh1_pg.C_160131 from Monosiga brevicollis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Monbr1|37785|estExt_fgenesh1_pg.C_160131
Domain Number 1 Region: 136-458
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-96
Family Protein kinases, catalytic subunit 0.0000000184
Further Details:      
 
Domain Number 2 Region: 4-108
Classification Level Classification E-value
Superfamily PH domain-like 5.25e-19
Family Pleckstrin-homology domain (PH domain) 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Monbr1|37785|estExt_fgenesh1_pg.C_160131
Sequence length 486
Sequence
MESRVIKEGKLLKRGEYISTWRVRWFILRDDGTFRGYKNRPMTPTDPPVNLFEIKDCTLG
VTDDDKSGKFGFSIRFVQMTRIIERTFYTETLEEREGWIQAINDVKARVDESQPADMRSE
YRAMSFIGGRPEAIEMDMDSFELLKVLGKGTFGKVMLARLKLNRKIYAMKVLKKSMVLEK
DELAHTLTENSVLAKASHPFLTSLHFSFQTPELLCFVMEYVNGGELFYHLRKEKRFSEER
VRFYASEITSALTYMHSEGIVYRDLKLENVMLSSEGHIKITDFGLAKEEIHYGDKTTTFV
GTPEYLAPEVIVDSEYGRAVDWWGLGVISYEMLAGALPFNSRDYEKLFNLILTQEVTFPA
HFSAEAADCISRLLDKEPSTRLGGAVNDGKDVMAHPWFHSIDWEALEAKTIDPPFVPKVR
GEDDVGNFDSYFTSENPILTPEDVSFGLLSLYPHPHGPAFRRLPVVLKHSGIYMGTPISI
LLVNFV
Download sequence
Identical sequences A9V404
81824.JGI37785 jgi|Monbr1|37785|estExt_fgenesh1_pg.C_160131 XP_001747333.1.20067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]