SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000008 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000008
Domain Number 1 Region: 158-181
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000262
Family CCCH zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000008   Gene: ENSOPRG00000000008   Transcript: ENSOPRT00000000008
Sequence length 188
Comment pep:novel genescaffold:pika:GeneScaffold_5142:14560:53919:1 gene:ENSOPRG00000000008 transcript:ENSOPRT00000000008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKRKKQNQQQPPPPLQPPLLEREETGEEEDRGRLGPPSLLGPPPMANGKPGDPKSALHR
GPPGSRGPMIPPLLSLPPPPRGRGPMRGGLGPRCGPYGRGWWGVNAEPPFPGPGLGGPSR
ESFHKEQRNPRRLKSWSLIKNTCPPKDGPQVLEDKSDRPVCRHFSKKGHCRYEDLCAFYH
PGVNGPPL
Download sequence
Identical sequences ENSOPRP00000000008 ENSOPRP00000000008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]