SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000133 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000133
Domain Number 1 Region: 238-416
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.8e-20
Family G proteins 0.0046
Further Details:      
 
Domain Number 2 Region: 492-580
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 8.63e-16
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0033
Further Details:      
 
Domain Number 3 Region: 402-488
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000000749
Family Elongation factors 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000133   Gene: ENSOPRG00000000150   Transcript: ENSOPRT00000000149
Sequence length 594
Comment pep:novel genescaffold:pika:GeneScaffold_1734:230426:237486:-1 gene:ENSOPRG00000000150 transcript:ENSOPRT00000000149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFGGCCRPGGPAMGGALKARGAGGSSGCGGPKGKKKNGRNRAGKANNPPYLPPEXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNYSDSRTAEEI
CESSSKMITFIDLAGHHKYLHTTIFGLTSYCPDCALLLVSANTGIAGTTREHLGLALALK
VPFFIVVSKVDLCAKTTVERTVRQLERVLKQPGCHKVPMLVTSEDDAVTAAQQFAQSPNI
TPIFTLSSVSGEGLDLLKVFLNILPPLTNSKEQEELMQQLTEFQVDEIYTVPEVGTVVGG
TLSSGICREGDQLVVGPTDDGCFLELRVCSIQRNRSACRVLRAGQAATLALGDFDRALLR
KGMVMVSPEMNPTICSVFEAEIVLLFHATTFRRGFQVTVHVGNVRQTAVVEKIHAKDKLR
TGEKAVVRFRFLKHPEYLKVGAKLLFREGVTKGIGHVTDVQAIAAGEAQASLGF
Download sequence
Identical sequences ENSOPRP00000000133 ENSOPRP00000000133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]