SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000264 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000264
Domain Number 1 Region: 73-238
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000068
Family BAR domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000264   Gene: ENSOPRG00000000293   Transcript: ENSOPRT00000000294
Sequence length 282
Comment pep:novel genescaffold:pika:GeneScaffold_5214:134326:156170:1 gene:ENSOPRG00000000293 transcript:ENSOPRT00000000294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDPPRVPSCARGKMLRRSLENRDAQTRQLQDAVTNVEKHFGELCQIFAAYVRKTARLRDK
ADLLVNEINIYASTETPHLKQGLKNFADEFAKLQDYRQAEVERLEAKVVEPLKAYGTIVK
MKRDDLKATLTARNREAKQLTQLERTRQRNPSDRHVIQAETELQRATMDATRTTRHLEET
IDNFEKQKIRDIKNIFSEFITIEMLFHGKALEVYTAAYQNIQKIDEDEDLEVFRNSLYPS
DYSSRLDIVRANSKSPLQRSLSAKCVSGTGQQIAISCQTSIY
Download sequence
Identical sequences ENSOPRP00000000264 ENSOPRP00000000264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]