SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000703 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000703
Domain Number 1 Region: 844-1028
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.44e-55
Family Eukaryotic proteases 0.00023
Further Details:      
 
Domain Number 2 Region: 447-568
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 5.89e-36
Family Frizzled cysteine-rich domain 0.00013
Further Details:      
 
Domain Number 3 Region: 132-244
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.66e-29
Family Frizzled cysteine-rich domain 0.00079
Further Details:      
 
Domain Number 4 Region: 648-690
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 5 Region: 574-611
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 263-300
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000694
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 338-373
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000122
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 377-417
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 298-337
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 614-646
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000034
Family LDL receptor-like module 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000000703
Domain Number - Region: 683-734
Classification Level Classification E-value
Superfamily SRCR-like 0.000615
Family Scavenger receptor cysteine-rich (SRCR) domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000703   Gene: ENSOPRG00000000761   Transcript: ENSOPRT00000000770
Sequence length 1036
Comment pep:novel genescaffold:pika:GeneScaffold_3473:417647:623835:-1 gene:ENSOPRG00000000761 transcript:ENSOPRT00000000770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAPAREERSCRAAAPKTVLGADDNNTGENCSQKLATAHLLRFLLLVLIPCICALVVLLVI
LLSFVGTLKKAYFKSNGSEPVVTDGEVQVSKVILTNAVYNQSALASTALPNQHVPAWTVD
PAVTEDHSQRNPSTCISIPHSQCQILPYQTTPVFSIVKHMDLEKFLKFFAYLHRLSCYQH
IMLFGCSLAFPECIIDGDDSHGLLPCRSFCEAAKEGCESVLGMVNSSWPDFLKCSQFRNQ
NESNNASRICFSPQQEDGKQLLCGGGESFLCASGICVPKKLQCNGYNDCDDWSDEAHCTC
GEDLFRCHTGKCLNHSLVCDGYDDCGDLSDERDCDCHPTKEHRCGDGRCITVEWVCDGDH
DCVDKSDEVNCSCHSQGLVECRSGQCIPGSFRCDGDEDCKDGSDEENCSDSQTPCQEGDP
RCLYNPCLDSCGGSALCDPNTGLNNCSQCELITLELCMNLPYNHTNFPNYLGHRTQKEAS
ISWESSLFPALVQTNCYKYLMFFACTILVPKCDENTGQRIPPCRALCEHAKERCESVLGI
VGLQWPEDTDCGQFPEEESDNQTCLMPDQDVEECSPSHFKCHSGRCVLASRRCDGQADCD
DDSDEENCGCKERDLWECPSNKQCLKPTLVCDGFPDCPDKMDEKNCSFCQADELECANHE
CVPRDRWCDGVANCADSSDEWDCVTLSQNVNSSSFLTVHRSATEQHVCADGWQETLSQLA
CKQMGLGEPSVTQRIEEQDKDQQWLMLRSNWESFNRTTLHELLINGXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XRENAAVWKVVLGINNLDHPSVFMQTRFVKNIILHPRYSRAVVDYDISIVELSEDINETS
YVRPVCLPSPEQSLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEQCQSYFDMKTITN
RMICAGYESGTVDSCMGDSGGPLVCEQPGGQWTLFGLTSWGSICFSKVLGPGVYSNVSYF
VKWIKREIYIQTFLLN
Download sequence
Identical sequences ENSOPRP00000000703 ENSOPRP00000000703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]