SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000767 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000767
Domain Number 1 Region: 485-611
Classification Level Classification E-value
Superfamily TIMP-like 8.63e-28
Family Netrin-like domain (NTR/C345C module) 0.083
Further Details:      
 
Domain Number 2 Region: 315-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000159
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 3 Region: 245-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000147
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 4 Region: 378-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000181
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000000767
Domain Number - Region: 84-146
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0357
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000767   Gene: ENSOPRG00000000822   Transcript: ENSOPRT00000000836
Sequence length 611
Comment pep:novel genescaffold:pika:GeneScaffold_421:47314:203048:-1 gene:ENSOPRG00000000822 transcript:ENSOPRT00000000836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGLSGVAGASSRCEKACNPRMGNLALGRRLWADTTCGQNATELYCFYSENADLTCRQPKC
DKCNAAHPHLAHLPSAMADSSFRFPRTWWQSAEDVHREKIQLDLEAEFYFTHLIMVFKSP
RPAAMVLDRSQDFGKTWKPYKYFATNCSAMFGLEDDVVKKGALCTSRYSSPFPCTGGEVI
FRALSPPYDAENPYSAKVQEQLKITNLRVQLLKRQSCPCQRNDLNTKPQHFTHYAIYDFI
VKGSCFCNGHADQCVPVDGFRPVKAPGTFHVVHGKCMCKHNTAGSHCQHCAPLYNDRPWE
AADGRTGAPKECRTCKCNGHADACHFDINVWEASGNQSGGVCNNCQHNTEGQHCQRCKPG
FYRDLRRPFSAPDACKVCSCHPVGSAVLPFSSVTFCDPSNGDCPCKPGVAGPHCDRCMVG
YWGFGNYGCRPCDCAGSCDPLTGDCTSSSTDIDWYHEMPDFYPTHNKSEPTWEWEDEQGF
SALRHSGKCECKEQVLGNPKAFCAMKYSYVLKIKILSAHDKGSHAEVNVKIKKVLKSTKL
KILRGKRTLYPESWTNRGCTCPILNPGLEYLVAGHEDVRTGKLVVNMKSFVQHWKPSLGR
KVMDILKRECK
Download sequence
Identical sequences ENSOPRP00000000767 ENSOPRP00000000767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]