SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001014 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001014
Domain Number 1 Region: 72-157
Classification Level Classification E-value
Superfamily TIMP-like 0.000000133
Family Netrin-like domain (NTR/C345C module) 0.048
Further Details:      
 
Domain Number 2 Region: 1-30
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00000667
Family Frizzled cysteine-rich domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001014   Gene: ENSOPRG00000001111   Transcript: ENSOPRT00000001100
Sequence length 170
Comment pep:novel genescaffold:pika:GeneScaffold_2747:708:2479:-1 gene:ENSOPRG00000001111 transcript:ENSOPRT00000001100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAPVMSAFGFWPDMLECDRFPQDNDLCIPLASSDHLLPATEEXXXXXXXXXXXXXXXXXX
XXXXXXXXXXLKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQC
TCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC
Download sequence
Identical sequences ENSOPRP00000001014 ENSOPRP00000001014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]