SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001434 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001434
Domain Number 1 Region: 13-61
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000136
Family G proteins 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000001434
Domain Number - Region: 149-188
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0224
Family G proteins 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001434   Gene: ENSOPRG00000001567   Transcript: ENSOPRT00000001556
Sequence length 208
Comment pep:novel genescaffold:pika:GeneScaffold_302:5057:11259:1 gene:ENSOPRG00000001567 transcript:ENSOPRT00000001556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQW
AILDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPYIETSAKDPPLNVDRAFHDLVRVIRQQIP
EKSQKKKKKTKWRGDRATGTHKLQCAIL
Download sequence
Identical sequences ENSOPRP00000001434 ENSOPRP00000001434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]