SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001478 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001478
Domain Number 1 Region: 77-346
Classification Level Classification E-value
Superfamily EndoU-like 4.05e-92
Family Eukaryotic EndoU ribonuclease 0.0000067
Further Details:      
 
Domain Number 2 Region: 28-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000549
Family Somatomedin B domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001478   Gene: ENSOPRG00000001615   Transcript: ENSOPRT00000001603
Sequence length 352
Comment pep:novel genescaffold:pika:GeneScaffold_4413:105194:108856:-1 gene:ENSOPRG00000001615 transcript:ENSOPRT00000001603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTEEPQPTVGPGEKSGTAAASSLYAAPGSCQDRCREAFDRHQPCHCDARCPHFRNCCEDF
QRLCEAHEGFSRSSDAISREELRSISERIYRADTNKARKEDIVLNSQICISPSETGDRVD
RCPEPLFNYVNEELFSKPTYAAFIQLLNNYQPATGHREHMGAQQLAEQQAFLREVMKTAI
MRELYDFLLQQNRYDSEQELVDDLHNMWFGLYSRSGEERDSSGFEHVFSGEIKKGKVTGF
HNWIRFYLQEKEGLVDYFSYVYDGPWNSYPDVLALQFSWDGFYKEVGSAFIGSSPEFEFA
LYSLCFIARPGRECQLSLGGHPLAIQTYTWDKSTYSNGRKYIATAYIVSSMQ
Download sequence
Identical sequences ENSOPRP00000001478 ENSOPRP00000001478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]