SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001631 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001631
Domain Number 1 Region: 335-459
Classification Level Classification E-value
Superfamily TIMP-like 1.57e-21
Family Tissue inhibitor of metalloproteinases, TIMP 0.015
Further Details:      
 
Domain Number 2 Region: 31-82
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000209
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001631   Gene: ENSOPRG00000001750   Transcript: ENSOPRT00000001767
Sequence length 461
Comment pep:novel genescaffold:pika:GeneScaffold_4698:678:9290:-1 gene:ENSOPRG00000001750 transcript:ENSOPRT00000001767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLLPRPLPVQNLLLLLGILLSCDLGGGAQGPGEWTLWGSWSRCSSSCGRGVSVRSRRCIR
LPGEDPCWGDSHEYRLCQLPDCAPGAVPFRDLQCALYNGLPVLGTHRTYQWVPFHGAPNQ
CDLNCLAEGQAFYHSFGRVLDGTPCSPGAPELCVAGRCLSPGCDGVLGSGATEDQCGRCG
GAADSCLRVQRVFRDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLGGDGHYVLNGNW
VLSAPGTYEVAGTHVVYTRTAGPEETLSATGPTSHDLLLQVLLREPNPGIEFEFWLPRER
YDPFQAQAQALGWSLRQPQPREVEPRPPAASHVTPAPDPCPPCPDARGRAHRLLHYCSSD
FVFQARVLGRHQHAQETRYEVRVERIYKSRGPLRGREYVWAPGRCPCPPLAPHRDYLLAV
RRLVSPDGTQDRLFLPQSGYARPWSPAEDSRARLAARRCPA
Download sequence
Identical sequences ENSOPRP00000001631 ENSOPRP00000001631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]