SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002051 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002051
Domain Number 1 Region: 344-473
Classification Level Classification E-value
Superfamily TIMP-like 8.48e-28
Family Tissue inhibitor of metalloproteinases, TIMP 0.053
Further Details:      
 
Domain Number 2 Region: 211-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 3 Region: 156-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000201
Family EGF-type module 0.089
Further Details:      
 
Domain Number 4 Region: 274-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000795
Family Laminin-type module 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002051   Gene: ENSOPRG00000002234   Transcript: ENSOPRT00000002222
Sequence length 487
Comment pep:novel scaffold:pika:scaffold_19368:9091:13176:1 gene:ENSOPRG00000002234 transcript:ENSOPRT00000002222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVVLVLWLLLGQATGDPCYDPGGRPRFCLPPVTQLARGPAASCPQACVLSQGTNPRALC
NDSLILALGGTFLLTSVSLRFCTPGPPALVLSSAWAAGGPWKLLWRSPAWSGALGGPKRV
TFRSQQGPKARVVASHLRVEVGGWAGLAAAGVRGRCQCHGHAAHCAARAQPPRCRCRHHT
TGPGCESCRPSHRDWPWRPATPRHPHPCLPCSCNLHARRCRFNSELFRLSGGRSGGVCER
CRHHTAGRHCHYCQPGFWRDPGQPITSRNACRACQCHPIGAIGGTCNQTSGQCSCKLGVT
GPTCNRCGPGYQQSRSPRMPCQRVPEATTPLVPTPRAHSSDPQCQNYCHLPDTSVHMSLS
RFCQQDYVLRAQVLAAEAAGPAWRRLAVRVLAVYKQRPLQPVRPGGQDAWVPEADLACGC
LRLRPGADYLLLGSAAHGPAPARLVLDRHGLALPWRPRWARPLRRLQQEERAGGCRGLQL
RTLSHGA
Download sequence
Identical sequences ENSOPRP00000002051 ENSOPRP00000002051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]