SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002796 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002796
Domain Number 1 Region: 23-136
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.53e-39
Family Frizzled cysteine-rich domain 0.00000221
Further Details:      
 
Domain Number 2 Region: 175-283
Classification Level Classification E-value
Superfamily TIMP-like 9.61e-18
Family Tissue inhibitor of metalloproteinases, TIMP 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002796   Gene: ENSOPRG00000003042   Transcript: ENSOPRT00000003034
Sequence length 346
Comment pep:novel scaffold:pika:scaffold_3329:51401:58951:-1 gene:ENSOPRG00000003042 transcript:ENSOPRT00000003034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSLLVALCLWLRLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQ
YEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWP
ENLACDELPVYDRGVXXXXXXXXXXXXXXVKWIDITPDMMVQERPLDVDCKRLSPDRCKC
KKVKPTLATYLSKNYSYVIHAKIKAVQRTGCNEVTTVVDVKEIFKSSSPIPRTQVPLVTN
SSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQQRTIQD
KKQTTGRTSRSHPPKPKGKPPAPKPANTKKNIKTRSTQKRKTPKRV
Download sequence
Identical sequences ENSOPRP00000002796 ENSOPRP00000002796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]