SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003130 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003130
Domain Number 1 Region: 30-211
Classification Level Classification E-value
Superfamily TIMP-like 3.73e-66
Family Tissue inhibitor of metalloproteinases, TIMP 0.0000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003130   Gene: ENSOPRG00000003424   Transcript: ENSOPRT00000003411
Sequence length 224
Comment pep:novel genescaffold:pika:GeneScaffold_2705:288221:294229:-1 gene:ENSOPRG00000003424 transcript:ENSOPRT00000003411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGSPLTTPSWALLLRLLALLRPPGLGEACSCAPAHPQQHVCHSALVIRAKISSEKVVPA
SADPDDTQKMIRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQV
LSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCICQITTCYTVPCVISAPNECLWTD
WLLERKLYGYQAQHYVCMKHVDGTCSWYQGHLSLRKEFVDILQP
Download sequence
Identical sequences XP_004581369.1.84141 ENSOPRP00000003130 ENSOPRP00000003130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]