SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003213 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003213
Domain Number 1 Region: 4-358
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.27e-100
Family G proteins 0.0000000024
Further Details:      
 
Domain Number 2 Region: 359-496
Classification Level Classification E-value
Superfamily Translation proteins 1.35e-43
Family Elongation factors 0.00000126
Further Details:      
 
Domain Number 3 Region: 499-569
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.94e-19
Family EF-G/eEF-2 domains III and V 0.0000539
Further Details:      
 
Domain Number 4 Region: 794-854
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000345
Family EF-G/eEF-2 domains III and V 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003213   Gene: ENSOPRG00000003490   Transcript: ENSOPRT00000003499
Sequence length 857
Comment pep:novel genescaffold:pika:GeneScaffold_3804:5046:11961:-1 gene:ENSOPRG00000003490 transcript:ENSOPRT00000003499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTR
KDEQERCITIKSTAISLFYELSENDLNFIKRSKDDSGFLINLIDSSGHVDFSSEETAALP
TDSALLVVHCWSGVCVQTETVLRQAIAERIQPVLMMNKMDRALLELQLEPEELYQTFQRI
VENVNVIISTYGEGEGGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKGE
GQLGPAERAKKVEDMMKKLWGDRYFDPATGKFSKSATSPDGKKLPRTFCQLILDPIFKVF
DAIMNFRKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPSP
VTAQKYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGLV
STGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVK
TGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEES
GEHIIAGAGELHLEICLKDLEEDHACIPIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRKR
KGLKEGIPALDNFLDKL
Download sequence
Identical sequences ENSOPRP00000003213 ENSOPRP00000003213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]