SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003334 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003334
Domain Number 1 Region: 24-196
Classification Level Classification E-value
Superfamily TIMP-like 2.75e-53
Family Tissue inhibitor of metalloproteinases, TIMP 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003334   Gene: ENSOPRG00000003631   Transcript: ENSOPRT00000003627
Sequence length 210
Comment pep:novel genescaffold:pika:GeneScaffold_4785:366899:413172:1 gene:ENSOPRG00000003631 transcript:ENSOPRT00000003627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPWLGLVVLLGSWGLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTL
VYTVKQMKMYRGFSKMPQVQYIYTEASESLCGLKLEVNKYQYLLTGRVYDDKIYTELCNC
VRCYLLSLSQRMGLYYRYHLXXXXXIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKH
YTCIRQKGGYCSWYRGWAPPDKSIINATDP
Download sequence
Identical sequences ENSOPRP00000003334 ENSOPRP00000003334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]