SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003442 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003442
Domain Number 1 Region: 5-53
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000000145
Family Ribosomal protein L35ae 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003442   Gene: ENSOPRG00000003763   Transcript: ENSOPRT00000003745
Sequence length 110
Comment pep:novel genescaffold:pika:GeneScaffold_1621:4332:8320:1 gene:ENSOPRG00000003763 transcript:ENSOPRT00000003745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRLWCKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMLYPSRI
Download sequence
Identical sequences ENSOPRP00000003442 ENSOPRP00000003442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]