SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003813 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003813
Domain Number 1 Region: 1369-1499
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 8.63e-38
Family Alpha-macroglobulin receptor domain 0.00069
Further Details:      
 
Domain Number 2 Region: 1498-1651
Classification Level Classification E-value
Superfamily TIMP-like 2.55e-36
Family Netrin-like domain (NTR/C345C module) 0.0027
Further Details:      
 
Domain Number 3 Region: 922-1031
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.2e-33
Family Complement components 0.00000164
Further Details:      
 
Domain Number 4 Region: 608-676
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 9.42e-19
Family Anaphylotoxins (complement system) 0.0011
Further Details:      
 
Domain Number 5 Region: 1165-1225
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.0000000000139
Family Complement components 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003813   Gene: ENSOPRG00000004052   Transcript: ENSOPRT00000004139
Sequence length 1653
Comment pep:novel genescaffold:pika:GeneScaffold_5134:329984:345608:1 gene:ENSOPRG00000004052 transcript:ENSOPRT00000004139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEQDFTLSSQKSYMLLSLQVPLTRVQSCGLYNLRRGPEVQLVARSPWLKDSLSKVTDTQG
INLLFSSRRGHIFLQTDQPIYNPGQGVRYRIFALDQNMRPSVDAMTVTVENSRGCLVRKE
GSRLPSSSFLYNFLIPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXLEINVDTTKKYRNGDPLKLHLKTDSPAFVALGAVDTALYAAGG
RAHKPLSMAKVFEVMNGYDLGCGPGGGDTALQVFQAAGLAFSDGDQLTSTRKSMSCPKEN
TRKKRNVNFQKAISEKLGQYASPEARRCCQDGLTQLPMRRSCEQRAARVPQPACREPFLS
CCQFAEDLRKKTRTKNQVGFARALEMVQEEELIEEDLIQVRSFFPENWLWKLETVDTSKV
LSMFVPDSLTTWEIHGVSVSGSTGLCVATPVRLQVFREFHLHLRLPPSVRRFEQLELRPV
LYNYLDEDLTVSVHVSPVEGLYMAGGGGLSQQVLVXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVGDAVSKVLQIEKEGVIHTEELVYELNPLDHRARTLEIPGKSDPNMIPDGDF
SSLVRVTASDPLDALGSEGALSPGGVVSLLRLPRGCGEQTMLYLAPTLAASRYLDKTEQW
SSLPPETKDHAVDLIQKGYMRIQQFRKTDGSYGAWLHRDSSTWLTAFVLKVLSLAQEQVG
GSPEKLQETANELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXPSPLPLNSSLSLHPATSPWMTSTAYASPLPLREGKAGMAERAAAWLNHQ
GSFPGGFRSTQDTVMALDALSAYWITSYTPEEKGLNVTLSSMGRSGLKFHTLQLNNHQVK
GLEEQLQFSLGNSISVQVNGNSKGTLKILRAYNVLDLKNTTCQDLQIEVTVTGHVEYTME
ANEDYEDYEEYGELPAGDDPDAHWQPVTPLQLFEGRRNRRRREAPKVAEEQESKVQYTVC
IWRNGKVGLSGMAIADITLLSGFPPLRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPK
NRECVGFGAVQEVAVGLVQPASAVLYDYYNPERKCSMFYGAPSKSKLLATLCSGTVCQCA
EGKCPRQRRALERGLQDEDGYRMKFACYSPRVEYGFQVKVLREDSRAAFRLFETQLIRIL
HFTSDAKATAGQTRNFLVRASCRLHLEPGKEYLIMGLDGVTEDLKGDPQYLLDSNTWIEE
MPSERLCRSTRQRAACNQLNSFLQEYGTQGCQV
Download sequence
Identical sequences ENSOPRP00000003813 ENSOPRP00000003813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]