SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004824 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004824
Domain Number 1 Region: 10-106
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.01e-35
Family Frizzled cysteine-rich domain 0.0000945
Further Details:      
 
Domain Number 2 Region: 148-251
Classification Level Classification E-value
Superfamily TIMP-like 0.000000000000029
Family Tissue inhibitor of metalloproteinases, TIMP 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004824   Gene: ENSOPRG00000005262   Transcript: ENSOPRT00000005250
Sequence length 261
Comment pep:novel genescaffold:pika:GeneScaffold_4870:540043:544003:-1 gene:ENSOPRG00000005262 transcript:ENSOPRT00000005250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRLDDPWHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVC
LDRPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPP
XXXXXXXXXXXXXXXXXXXXXXXXXXXVKMRIKEVKLENGDRKLIGAQKKKKLLKPGPLK
RKDTKRLVLHMKNGAGCPCPQLDSLTGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVK
FMFSYPCSLYYPFFYGAAEPH
Download sequence
Identical sequences ENSOPRP00000004824 ENSOPRP00000004824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]