SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004927 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004927
Domain Number 1 Region: 995-1278
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 6.28e-95
Family Complement components 0.00000000101
Further Details:      
 
Domain Number 2 Region: 1385-1507
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 4.05e-33
Family Alpha-macroglobulin receptor domain 0.0006
Further Details:      
 
Domain Number 3 Region: 674-737
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 2.35e-18
Family Anaphylotoxins (complement system) 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000004927
Domain Number - Region: 1506-1537
Classification Level Classification E-value
Superfamily TIMP-like 0.000636
Family Netrin-like domain (NTR/C345C module) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004927   Gene: ENSOPRG00000005319   Transcript: ENSOPRT00000005367
Sequence length 1537
Comment pep:novel genescaffold:pika:GeneScaffold_1769:955:24731:-1 gene:ENSOPRG00000005319 transcript:ENSOPRT00000005367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAALGPGPLLLLLPCLPLVLGDPMYSIITPNIIRLDNDETVVLEAHDVAADIPVTVTIH
DFGQEQVLFSEKLVLTSATGYLGYVTFKIPSNKDLKLGSGPKYLTVLASFADTTVEKAVL
LSLHNGYLFVQTDKTIYTPGSSVLYRVFTVDHNLLPVGRTVIVTIENPEGVTVKRSTLSS
HNQHGILPLSWPIPELVNMGQWKIRAFYENSPQRVFSAEFEVKEYVLPSFEVILEPMEKF
YYIDDPQGLQVTIMARFLYGKNVDGTAFVIFGVQDEDQRISLAHSLTRVEILDGHGEAML
KRQVLLDGVDPSQPEALVGKSLYVSATVILQSGSDMVEAERTGIPIVTSPYKIHFTKTPT
FFKPAMPFDLMVFVTNPDGSPARHVPVVTQDSDVQSLTQEDGVAKLSINTPNSRQPLPIT
VRTKKDGIPEARQATNTMQALPYTTLYNSNNYLHLSLPRTELKPGEPLHVHFHLRTDPGQ
DAKIRYYTYLIMNKGRLLKAGRQVREAGQDLVVLPLTITPEFIPSFRLVAYYTLIDAKGK
REVVADSVWVDVKDTCVGTLVVKGGGRDGQQHLPGQQMTLKLEGDRGARVGLVAVDKGVF
VLNKKNKLTQSKIWDVVEKADIGCTPGSGKDYAGVFTDAGLSFMSNKALQTEQRKQLECP
KPAARQRRSVQLQEKRADKKDKVLRRCCEGGMRENPMEFSCDQRARFIALGQACVQAFLD
CCKYLARLREQHRREGTLSLARSDLDEDIIPEEDIVSRSHFPESWLWTIEEFKEPAKNGI
STKIMNVFLKDSITTWEIMAVSLSDKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXPEGIPVNKTVTVRTLDPENLGQGGFQKEEIPPAD
LSDQVPETEAETKILLQXXXXXXXXXXXXXXXXXXHLIVTPSGCGEQNMISMTPTVIAVH
YLDLTEQWEKYPLGKRDEALELIKKGYTQQLAFKQPNSAYAAFLNRPPSTWLTAYVVKVF
SLAANLIAIDSRVLCGAVKWLIMEKQKPDGVFQEDAPVIHQEMIGGFRNSAEKEVSLTAF
VLIALQEAREICEEQINSLPASISKSKDFISKNYLNLQRPYSIAIAGYALAQQEELQGEL
LNKFLSTAKDRNRWEEPGQHLYNVEATSYALLALLRLRDMDSLPAVARWLNEQRYYGGGY
GSTQATFMVFQALAQYQVEMPDHKDLNLEVSIKLPSRSSAVKHLILWESASLLRSEEXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXYLGDEDATMSILDISMMTGFVPDTDDLNLLSNGIDRYISKYELSKAFSHKNTLII
YLDKISHIAEDCLSFKVHQFFNVGLIQPGSVKVYSYYNLEEACTVFYHPDKEDGMLSKLC
HKDMCRCAEENCFLQQPDNKVTENERLDKACEPGVDY
Download sequence
Identical sequences ENSOPRP00000004927 ENSOPRP00000004927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]