SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005224 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005224
Domain Number 1 Region: 4-115
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-36
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 126-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-28
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 3 Region: 346-387
Classification Level Classification E-value
Superfamily TIMP-like 0.000000942
Family Netrin-like domain (NTR/C345C module) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005224   Gene: ENSOPRG00000005691   Transcript: ENSOPRT00000005689
Sequence length 387
Comment pep:novel genescaffold:pika:GeneScaffold_3516:958:62813:-1 gene:ENSOPRG00000005691 transcript:ENSOPRT00000005689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVFSCGGILSGESGFIGSEGFPGVYPPNSKCTWKITVPEGKVVVLNFRFIDLESDNLCRY
DFVDVYNGHANGQRIGRFCGTFRPGALESSGNKMMVQMISDANTAGNGFMAMFSAAEPNE
RGDQYCGGRLERSSGSFKTPNWPDRDYPAGVTCVWHIVAPKNQXXXXXXXXXXVERDNYC
RYDYVAVFNGGEVNDARRIGKFCGDSPPAPVVSDSNELLVQFFSDLSLTADGFIGHYKFR
PRKLPATTVPPVTTTVPVTAGLKPTVALCQQKCRRSGTLESNYCSSNFXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNYIIMGQVGEDGRG
RIMPNSFILMFKTKNQKLLNALKNKQC
Download sequence
Identical sequences ENSOPRP00000005224 ENSOPRP00000005224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]