SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005655 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005655
Domain Number 1 Region: 38-152
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.79e-42
Family Frizzled cysteine-rich domain 0.00000794
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005655   Gene: ENSOPRG00000006173   Transcript: ENSOPRT00000006167
Sequence length 490
Comment pep:novel scaffold:pika:scaffold_108964:472:1978:1 gene:ENSOPRG00000006173 transcript:ENSOPRT00000006167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRSALPRLLLLLLLLPAAGPAQFHGEKGISVPDHGFCQPISIPLCTDIAYNQTIMPNL
LGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQG
CEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGGGTPG
GPGGGGGGTPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQE
ETRFARLWILTWSVLCCASTLFTVTTYLDMQRFRYPKRPIILLSGCYNMVSVAYIAGFVL
QERVVCNERFSDDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKW
GHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL
FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACY
FYEQAFREHW
Download sequence
Identical sequences ENSOPRP00000005655 ENSOPRP00000005655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]