SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006431 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006431
Domain Number 1 Region: 4-171
Classification Level Classification E-value
Superfamily Translation proteins 5.92e-37
Family Ribosomal protein L3 0.00037
Further Details:      
 
Domain Number 2 Region: 276-375
Classification Level Classification E-value
Superfamily Translation proteins 1.77e-19
Family Ribosomal protein L3 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006431   Gene: ENSOPRG00000007029   Transcript: ENSOPRT00000007022
Sequence length 406
Comment pep:novel genescaffold:pika:GeneScaffold_2530:4292:11212:-1 gene:ENSOPRG00000007029 transcript:ENSOPRT00000007022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHRKFSAPRHGHLGFLPHKRSRRHRGKVKTWPRDDPSQPVHLTAFLGYKAGMTHTLREV
HRPELKISKREEVEAVTIVETPPLVVVGVVGYVATPRGLRSFKTVFAQHLSDECRRRFYK
DWHRSRKKAFTKACKRWRDADGKRQLQKDFAAMKKYCKVIRVIVHTQXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPRTEVNTKIYRIGRGLHVQDGKMVR
NNASTSYDVTDKSITPLGGFPHYGEVNNDFVMLKGCIAGTKKRVITLRKSLLVHHSRRAL
ESVELKFIDTTSKFGHGRFQTAQEKRAFMGPQKKHLEEKPEAAGDL
Download sequence
Identical sequences ENSOPRP00000006431 ENSOPRP00000006431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]