SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007050 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007050
Domain Number 1 Region: 160-463
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.53e-67
Family Papain-like 0.0000127
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000007050
Domain Number - Region: 93-157
Classification Level Classification E-value
Superfamily FnI-like domain 0.000157
Family VWC domain 0.068
Further Details:      
 
Domain Number - Region: 74-106
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000275
Family Somatomedin B domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007050   Gene: ENSOPRG00000007695   Transcript: ENSOPRT00000007698
Sequence length 472
Comment pep:novel genescaffold:pika:GeneScaffold_2320:65345:173880:1 gene:ENSOPRG00000007695 transcript:ENSOPRT00000007698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWNVHKFFIFFYLTTEIWTQKLYLSQRKADLGVYFSRNHTAVEGIRFKRSIFQGQYCRSF
GCCKDRNDECVTEFYEANALCYCDKFCEREISDCCPDYKSFCHEEKELPLHTQSWNPEGC
SKNGQHYGEGTVIKENCNSCTCSGQQWKCSQRKCLVLPELIEHINKGDYGWTAQNYSQFW
GMTLEEGFKFLLGTLPPSPMLLGMNEMTASLPARTDLPEFFVASYKWPGWTHGPLDQKNC
AASWAFSTASVAADRIAIQSNGRYTANLSPQNLISCCAKNRHGCNSGSVDRAWWYLRKRG
LVSHACYPLFKDQNVANNSCAMTSKADGRGKRHATKPCPNNIEKSNRIYQCSPPYRVSSN
ETEIMREILQNGPVQAIMQVHQDFFYYKTGIYRHVASTNSKYRKLRTHAVLTGWGTLKGA
RGQKEKFWIAANSWGKSWGENGYFRILRGVNESDIEKLIIAAWGQLTSSDVA
Download sequence
Identical sequences ENSOPRP00000007050 ENSOPRP00000007050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]