SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007364 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007364
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-38
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 2 Region: 36-131
Classification Level Classification E-value
Superfamily C-type lectin-like 3.77e-37
Family Link domain 0.00000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007364   Gene: ENSOPRG00000008056   Transcript: ENSOPRT00000008048
Sequence length 276
Comment pep:novel genescaffold:pika:GeneScaffold_4632:158273:192164:1 gene:ENSOPRG00000008056 transcript:ENSOPRT00000008048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIILPYLFVLMWEEAQGWGYRNGTFHNSIWLERAAGVYHREARSGRYKLTYAEAKAVCEF
EGGRLATYKQLEAARKIGFHVCSAGWMAKGRVGYPIVKPGSNCGFGKVGIIDYGIRLNRS
ERWDAYCYNPNAKECGGVFTDPKRIFKSPGYPNEYDDNQVCYWHIRIKYGQRIHLSFLKF
DLEDDPGCLADYVEVYDSYDDVHGFVGRYCGDELPGDIISTGNVMTLKFLSDASVTAGGF
QIMYVAMDPASKSSQGKNTTTTSGNKNALAGRYSHF
Download sequence
Identical sequences ENSOPRP00000007364 ENSOPRP00000007364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]