SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008184 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008184
Domain Number 1 Region: 23-138
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.88e-38
Family Frizzled cysteine-rich domain 0.0000852
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008184   Gene: ENSOPRG00000008948   Transcript: ENSOPRT00000008939
Sequence length 705
Comment pep:novel genescaffold:pika:GeneScaffold_3631:155088:206911:1 gene:ENSOPRG00000008948 transcript:ENSOPRT00000008939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METFAFLLICVCLPLVRGHSLFTCEPITVPRCMKMTYNMTFFPNLMGHYDQEIAAVEMKH
FLPLANLKCSPNVETFLCKAFIPTCTEQIHVIPPCRKFCEKVYSDCRKLIDTFGIRWPEE
LECNRLQYCDENVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGAPGFLTVLLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCVCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYEQVNRVTWEITWVSDHCHQYHIPCPYQAKTKARPELALFMIKY
LMTLIVGILPVFWVGSKKTCTEFSWFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITDHDFLGQETLTEVQTSPETSVREV
RADGASTPKVREQDCGDPISVVATSSKLCGEQADGKGLAGSVSEGMQSERVSPKSDVTET
GPGPSHGVQMSSSPDADSPKGSTSLLVRSAPAVRKEQGAGKPPDT
Download sequence
Identical sequences ENSOPRP00000008184 ENSOPRP00000008184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]