SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008253 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008253
Domain Number 1 Region: 6-76
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0000000000000034
Family Frizzled cysteine-rich domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008253   Gene: ENSOPRG00000009021   Transcript: ENSOPRT00000009016
Sequence length 668
Comment pep:novel genescaffold:pika:GeneScaffold_3269:132173:139096:1 gene:ENSOPRG00000009021 transcript:ENSOPRT00000009016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRNAPRCWAVIQPLLCAVYMPKCENERVELPSRTLCQATRGPCAIVERERGWPDFLRCTP
DHFPEGCPNEVQKIKFXXXXXXXXXXXRTDNPKSWYEDVEGCGIQCQNPLYTEAEHQDMH
AYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARR
EIVCRADGTMRIGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFRALGTTYQ
PLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLV
LIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHF
YDFFNQAEWERSFRDYVLCQANVTIGLPTKKPIPDCEIKNRPSLLVEKINLFAMFGTGIS
MSTWVWTKATLLIWRRAWCRLTGQSDDEPKRIKKSKMIAKAFSKRRELLQNPGQELSFSM
HTVSHDGPVAGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDVSVTPVATPVPPEEH
ANRWLVEAEISPELEKRLGRKKKRRKRKKEVCPLGPPVEPRPPAPVPSTVPRLPQLPHRR
CLVAAGAWGAGESSRHGAWTLVSNPFCPEPSAPAAPTTWTQGRRQGLGPIHSRTNLMEAE
LLDADSDF
Download sequence
Identical sequences ENSOPRP00000008253 ENSOPRP00000008253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]