SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008791 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008791
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.07e-30
Family Ras-binding domain, RBD 0.00000526
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000008791
Domain Number - Region: 148-347
Classification Level Classification E-value
Superfamily Tropomyosin 0.0582
Family Tropomyosin 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008791   Gene: ENSOPRG00000009628   Transcript: ENSOPRT00000009616
Sequence length 419
Comment pep:novel genescaffold:pika:GeneScaffold_1215:7590:18433:1 gene:ENSOPRG00000009628 transcript:ENSOPRT00000009616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPI
ISLNKWGQYASDVQLILRRTGPSLSERPTSDSVARIPERTLYRQSLPPLAKLRPQIDKSI
KRREPKRKSLTFTGGAKGLMDIFGKGKETEFKQRVLNNCKTSADELKKLIRLQTEKLQSI
EKQLESNDIEIRFWEQKYSSSLEEEIVRLEQKIKRNDVEIEEEEFWENELQIEQENEKQL
KDQLQEIRQKIADCENKLKDYLAQIQTMESGLEAEKLQREVQEAQVNEEEVKGKIGKVRG
EIDVQGQQSLRLENGIKAVERSLGQATKRLQDKEQELEQLTKELRQVNLQQFIQQTGTKV
TVLPAEPIEIEASHTDIDREPTFQSGSLKRPGSSRQLPSNLRILQSPVSSGFNPEGIYV
Download sequence
Identical sequences ENSOPRP00000008791 XP_004592685.1.84141 ENSOPRP00000008791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]