SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008997 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008997
Domain Number 1 Region: 446-712
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.13e-66
Family Protein kinases, catalytic subunit 0.00000061
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000008997
Domain Number - Region: 187-228
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0889
Family Frizzled cysteine-rich domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008997   Gene: ENSOPRG00000009841   Transcript: ENSOPRT00000009844
Sequence length 904
Comment pep:novel genescaffold:pika:GeneScaffold_3885:214387:234975:-1 gene:ENSOPRG00000009841 transcript:ENSOPRT00000009844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELEVPDPIDPLGPLEGQDGPMPTLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXPTHSPNHNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAFTMI
GTSTHLSDQCSQFAIPSFCHFVFPLCDARSRAPKPRELCRDECEVLESDLCRQEYTIARS
NPLILMRLQLPKCEALPLPDSPDAANCMRIGIPAEGRXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
PRDSSKMGILYILVPSIAIPLVIACLFFLVCMCRNKQKASTSAPQRRQLMASPSQDMEMP
LINQHKQAKLKEISLTVRFMEELGEDFGKVYKGHLFGATGEQTAVAIKTLKDKAEGPLRE
EFRLEAMLRARLQHPNVVCLLGVVTKEQPLSMIFNYCPHGDLHEFLVMRSPHSDVGSTDD
DRTVKSALEPPDFVHVVAQIAAGMEYLSSHHVVHKDLATRNVLVYDKLAVKISDLGLFRE
VYSADYYKLMGNSLLPIRWMSPEAIMYGKFSVDSDIWSYGVVLWEVFSYGLQPYCGYSNQ
DVVEMIRNRQVLPCPDDCPAWVYALMIECWNEFPSRSPRFKDIHSRLRAWGIVSGYHSSA
QTSGASNTTQTSSLSTSPVSNVSNARYLGKQKAQPFPQPQLIPMKGQIRPMVPPPQLYIP
VNGYQPVPAYGAYLPNFYPVQIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSN
TSVADRAALLSEGTEDTQNVPEDVAQSPVLEAEEEEEEGSVPETELLGDNDTVQMDEAQV
QLEA
Download sequence
Identical sequences ENSOPRP00000008997 ENSOPRP00000008997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]