SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009888 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009888
Domain Number 1 Region: 1267-1474
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-44
Family Laminin G-like module 0.00018
Further Details:      
 
Domain Number 2 Region: 1752-1958
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-38
Family Laminin G-like module 0.000000344
Further Details:      
 
Domain Number 3 Region: 1-88
Classification Level Classification E-value
Superfamily TIMP-like 1.65e-36
Family The laminin-binding domain of agrin 0.00000599
Further Details:      
 
Domain Number 4 Region: 104-174
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000832
Family Ovomucoid domain III-like 0.0056
Further Details:      
 
Domain Number 5 Region: 482-531
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000152
Family Ovomucoid domain III-like 0.013
Further Details:      
 
Domain Number 6 Region: 426-466
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000499
Family Ovomucoid domain III-like 0.0077
Further Details:      
 
Domain Number 7 Region: 630-681
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000735
Family Ovomucoid domain III-like 0.0041
Further Details:      
 
Domain Number 8 Region: 344-392
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000388
Family Ovomucoid domain III-like 0.0062
Further Details:      
 
Domain Number 9 Region: 549-596
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000471
Family Ovomucoid domain III-like 0.0093
Further Details:      
 
Domain Number 10 Region: 834-899
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000061
Family Ovomucoid domain III-like 0.0074
Further Details:      
 
Domain Number 11 Region: 180-250
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000103
Family Ovomucoid domain III-like 0.0082
Further Details:      
 
Domain Number 12 Region: 724-767
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000159
Family Laminin-type module 0.0046
Further Details:      
 
Domain Number 13 Region: 278-324
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000116
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 14 Region: 1077-1110
Classification Level Classification E-value
Superfamily SEA domain 0.00000876
Family SEA domain 0.0043
Further Details:      
 
Domain Number 15 Region: 778-815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000781
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000009888
Domain Number - Region: 1467-1502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000469
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 1667-1724
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000518
Family Laminin G-like module 0.024
Further Details:      
 
Domain Number - Region: 1505-1543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000533
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009888   Gene: ENSOPRG00000010800   Transcript: ENSOPRT00000010822
Sequence length 1960
Comment pep:novel genescaffold:pika:GeneScaffold_4793:1059:25443:1 gene:ENSOPRG00000010800 transcript:ENSOPRT00000010822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRVWRYLKGKDVVAQESLLDGGNKVVIGGFGDPLICDNQVSTGDTRIFFVNPAPPSLWPA
HKNELMLNSSLMRITLRNLEEVELCVXXXXXXXXXXXXXXXXXCRGVLCGFGAVCEPSTE
QPGRASCVCPPRACPAVVAPVCGSDASTYSNECELQRVQCSQQRRIRLLRRGPCGSHDPC
SNVTCSFGSICVSSPDGRMASCQCPTSCRGAPSATVCGTDGNDYPGECELRHHACTRQED
LAKKFDGPCDPCQGALSDPSRLCWVNPRTRLPELLLRPENCPPRRAPICADDGVTYDNDC
VMGRSAARGLLLQKVRSGPCQPRDQCPEACHFHAVCLSRRGRASCSCDRVVCDGAYRPVC
AQDGRTYDNECWRQQAECRQQRAIPARHPGPCXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXYDPVCGSDGVTYGSACELGVTACALQQEIHVARKGPCDPCGQCRFGALCEAE
TGRCVCPSECVASAQPVCGSDGHTYASECEMDVHACTHQIILHVASAGPCKTCGDTVCAF
GAVCSAGRCVCPRCEHTPTGPVCGSDGVSYRDICELRATACQRQTHIEEVRAGPCEQAEC
GSGGSGSGEGGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQGVPRSPVCGSDGLTYSTEC
ELKKTRCAAQRELYVVAQGTCRGPTSAPLLPVTPWHCAQTPYGCCPDNMTAALGVGLAGC
PSACQCNPHGSYGSTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTPCSC
DPRGAVRDDCEQMTGLCSCRPGVAGPKCGQCPGGRTLGSSGCEADSPPASCVDLQCEFGS
SCVEEDGSAHCICPALPCPETNTTKVCGSDGITYASECQLQTIACRQGLLVSVQGLGPCQ
EAVTPGVHPTFLPVTSLGLIPSQPVLPQLPHTLPPLPSSTLGSQPTPPPSPLPRTTAGIP
RTSARLVLTAPPTAPPEATGLATSAFGGSGSADGSGDEELSGDQEASGGGSEGPEVPGGG
SRVTLGPPVERASCYNAPLGCCSDGKTPSLDAEGSNCPATRAFQGVLELEGVEGQELFYT
PEMADPKSELFGETARSIESVLDHLFRNSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWVPALLTGVTTGATTARATT
GHWPPSTVTPRTHTSQPAVRGTAPLTTRRPPTTTPSRGRGLRPSRPRPCDSQPCLHGGTC
QDQAGGQGFACSCPVGREGALCEKALHPSVPAFGGHSFLAFPTLRAYHTLRLALEFRALE
PRGLLLYNGNAKGKDFLALVLLDGHVQLRFDTGSGPAVLSSSVPVQPGRWHRLELSRHWR
RGSLSVDGEAPITGESPSGTDGLNLDTELFVGGVPEDQAAVVLERTSVGLGLSGCIRLLD
VNNQRLELGGWQGSALRSKDVGECGPHPCLPNPCRGAAPCQALEDGMFHCQCPPGRFGPT
CADEKNPCLPNPCHGAAPCRVVPEGGAKCECPLGRGGALCQTALEDNSRPFLAEFGGFSY
LQLGGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPHTVLNLKEPLYV
GGAPDFSKLARAAAVASGFDGAIQLVALQGRQLLSQEHVLQAVDVAIFGDHPCTQASGHP
CLHGATCVPQEAAYDCLCPPGFSGRHCEEGLLERSAGDLGALVFDGQTFVEYLSAGTESE
KALQSNHFELSLRTEATQGLVLWIGKATERADYMALAIVDGRLQLSYNLGSQPVVLRSSV
PVNTNRWLRVRAHREQREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLQRLPVGQAL
PKAYSTGFVGCLRDVMVGQRPLHLLEDAVAKPELRPCPGP
Download sequence
Identical sequences ENSOPRP00000009888 ENSOPRP00000009888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]