SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Ochotona princeps 69 > ENSOPRP00000010207

Domain assignment for ENSOPRP00000010207 from Ochotona princeps 69

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSOPRP00000010207
Domain Number 1	Region: 235-275
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	3.79e-16
Family	CCCH zinc finger	0.00091
Further Details:

Domain Number 2	Region: 207-233
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.00000000235
Family	CCCH zinc finger	0.0017
Further Details:

Domain Number 3	Region: 180-204
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.000000863
Family	CCCH zinc finger	0.0045
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSOPRP00000010207 Gene: ENSOPRG00000011183 Transcript: ENSOPRT00000011179
Sequence length	278
Comment	pep:novel genescaffold:pika:GeneScaffold_3069:212213:225783:-1 gene:ENSOPRG00000011183 transcript:ENSOPRT00000011179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	TDDEVDDSDNEETQEEKIKWGVKLESEQIPKKVKRFGNSTSPPKKPLRIKSRSKDYDTYS DDDVCAQDSEDTFAQELQQYIKAKEMASATRSFTLPEHSVAEEGVNGAQQATKQKNKKSK AGQKNGKQKKTKRKWSDTGNKGSNGLPRKKGSQEEDGKPKEKRQPVMSQGFINQHTVVRE GKQICKYFLERKCIKGDQCKFDHDAEIEKKKMMCKFYVQGYCTRGENCLFLHNEYPCKFY HTGTKCYQGEYCKFSHAPLTDETRELLARVLDAEKKCK
Download sequence
Identical sequences	ENSOPRP00000010207 ENSOPRP00000010207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]