SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010656 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000010656
Domain Number - Region: 222-269
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00144
Family Frizzled cysteine-rich domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010656   Gene: ENSOPRG00000011676   Transcript: ENSOPRT00000011679
Sequence length 547
Comment pep:novel genescaffold:pika:GeneScaffold_5286:112928:433866:1 gene:ENSOPRG00000011676 transcript:ENSOPRT00000011679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPARNKEQTCEVRLQWRLPAVKGLQETRAXXXXXXXXXXXXXXXXXXXGRRFQIASRKDM
QQLLQASSSTLKLLISRNAAAFQETLETLIKQAENYTSILFCNTYRNMALEAAASVQEFF
TDVGLYVFGVDVNLEEFVNRFFDSLFPLVYNHLINPDVTDSSLEYSECIRMACREVSPFG
NIPKRVMGQMGRSLLPSRTFLQALNLGIEVINTTDHLRFSKECSKALLKMQYCPHCQGLT
VSKPCMGYCLNVVRGCLANMAELNPHWHAYIRSLEELSDAMRGTYDIEHVLLNFHLLVND
AILQAHLNGPQLLEQINRICGRPVRSPTRSPRCSFDESKEKQGVKISARSGEETLANRRK
EFINSLRLYRSFYGMLADQLCVNELAAAEGLPCWNGEDMVNXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXLLQGRSAKPNKWELLQLGSGGGTPEQVSGDCDDEDVCA
GSGSGEVKRTLKITNWIPEDLNFSDVKQVHHRGSSSTLDTTGADCAAVRASVAFTVTGVV
MLLPRLW
Download sequence
Identical sequences ENSOPRP00000010656 ENSOPRP00000010656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]