SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011028 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011028
Domain Number 1 Region: 98-173
Classification Level Classification E-value
Superfamily Translation proteins 1.06e-17
Family Gar1-like SnoRNP 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011028   Gene: ENSOPRG00000012089   Transcript: ENSOPRT00000012082
Sequence length 245
Comment pep:novel genescaffold:pika:GeneScaffold_1151:126:7084:1 gene:ENSOPRG00000012089 transcript:ENSOPRT00000012082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGRYCRGGSTRRGRVCAPRGREAHVASAEEIMSFRGGGRGGFNRGGGGGGFNRGGGNSHF
RGGGGGFRGGGGRGGFGRGGGRGGFNKGQDQGPPEHVVILGEFMHPCEDDIVCKCTTDEN
KVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKYYIDPYKPPL
QEGPWPRPPGRKGPPRGGGGAGAGGAGRGRGGEGGGRGGGFRGGRGGGGGGFRGRGGGGF
RGRGH
Download sequence
Identical sequences ENSOPRP00000011028 ENSOPRP00000011028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]