SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011401 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011401
Domain Number 1 Region: 690-698,735-901,956-985
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.43e-32
Family Translational machinery components 0.0089
Further Details:      
 
Domain Number 2 Region: 82-128
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.45e-18
Family G proteins 0.0014
Further Details:      
 
Domain Number 3 Region: 614-688
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.26e-17
Family EF-G/eEF-2 domains III and V 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011401   Gene: ENSOPRG00000012488   Transcript: ENSOPRT00000012487
Sequence length 1124
Comment pep:novel genescaffold:pika:GeneScaffold_2518:50882:145479:-1 gene:ENSOPRG00000012488 transcript:ENSOPRT00000012487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IAISSLIKVIQLWRNNESISNVCVLVHADRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXNDEYLINLIDSPGHVDFSSEVSTAVRICDGCIIVVDAV
EGVCPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXIEHFAKIYSQKIGIKKEVLLKTLWGNYYINMKAKKIMKADQXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGGLQDSVLKSATLCS
LSSCPPFIPLSFEATPIVRVAIEPKHPSEMPQLVKGMKLLNQADPCVQILIQETGEHVLV
TAGEVHLQRCLDDLTERFAKIQISVSEPIIPFRETITKPPKVDMVNEEIGKQQKVAVIHQ
TKEDQSRIPEGIQVDSDGLITMTTPNKLATLSVRAMPLPEEVTQILEANSDLIRAMEQLT
SSISEGKNSEAVHQRTQEKILEFKGKLEQHLTGRKWRNTVDQIWSFGPRKCGPNILVNKS
ENFEHSVWTGPTSKASKEASRFRDLGNSIVSGFQLATLSGPMCEEPLMGVCFVLEKWDLS
RLEEPAASHRQNLEPEEQVEAKHTSNGGEDRELHEDEPPEPGEKRTAQKGDSSLTDCYGP
FSGQLIATMKEACRYALQVKPQRLMAAMYTCDIMATSDVLXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIPSDPFWVPTTEEEYLH
FGEKADSENQARKYMNAVRKRKGLYVEEKIVEHAEKQRTLSKNK
Download sequence
Identical sequences ENSOPRP00000011401 ENSOPRP00000011401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]